Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 2299202..2300001 | Replicon | chromosome |
Accession | NZ_CP117568 | ||
Organism | Escherichia albertii strain BIA_5-2 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | A0A8H9C2I0 |
Locus tag | PS053_RS11110 | Protein ID | WP_059227548.1 |
Coordinates | 2299537..2300001 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1PPV5 |
Locus tag | PS053_RS11105 | Protein ID | WP_001296435.1 |
Coordinates | 2299202..2299537 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS053_RS11090 (2294991) | 2294991..2295761 | - | 771 | WP_025238278.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
PS053_RS11095 (2295777) | 2295777..2297111 | - | 1335 | WP_025238277.1 | galactarate/glucarate/glycerate transporter GarP | - |
PS053_RS11100 (2297482) | 2297482..2299053 | + | 1572 | WP_256878808.1 | galactarate dehydratase | - |
PS053_RS11105 (2299202) | 2299202..2299537 | + | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
PS053_RS11110 (2299537) | 2299537..2300001 | + | 465 | WP_059227548.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
PS053_RS11115 (2300056) | 2300056..2300865 | - | 810 | WP_000072169.1 | aga operon transcriptional regulator AgaR | - |
PS053_RS11120 (2301114) | 2301114..2302394 | + | 1281 | WP_256878807.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
PS053_RS11125 (2302417) | 2302417..2302890 | + | 474 | WP_002461030.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
PS053_RS11130 (2302901) | 2302901..2303680 | + | 780 | WP_000406226.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
PS053_RS11135 (2303670) | 2303670..2304548 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
PS053_RS11140 (2304566) | 2304566..2305000 | + | 435 | WP_149451364.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17819.26 Da Isoelectric Point: 9.7301
>T271435 WP_059227548.1 NZ_CP117568:2299537-2300001 [Escherichia albertii]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRFRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTQETEEKH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRFRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTQETEEKH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|