Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 2257748..2258475 | Replicon | chromosome |
| Accession | NZ_CP117568 | ||
| Organism | Escherichia albertii strain BIA_5-2 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9ZMR4 |
| Locus tag | PS053_RS10910 | Protein ID | WP_000550189.1 |
| Coordinates | 2258161..2258475 (-) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PS053_RS10905 | Protein ID | WP_256878813.1 |
| Coordinates | 2257748..2258164 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS053_RS10895 (2252841) | 2252841..2255192 | + | 2352 | WP_000695424.1 | alpha-glucosidase | - |
| PS053_RS10900 (2255640) | 2255640..2257658 | + | 2019 | WP_256878814.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
| PS053_RS10905 (2257748) | 2257748..2258164 | - | 417 | WP_256878813.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| PS053_RS10910 (2258161) | 2258161..2258475 | - | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| PS053_RS10915 (2258758) | 2258758..2259894 | - | 1137 | WP_060877474.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
| PS053_RS10920 (2259979) | 2259979..2260482 | + | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
| PS053_RS10925 (2260559) | 2260559..2261251 | + | 693 | WP_000942533.1 | vancomycin high temperature exclusion protein | - |
| PS053_RS10930 (2261330) | 2261330..2262316 | + | 987 | WP_000617693.1 | Gfo/Idh/MocA family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T271434 WP_000550189.1 NZ_CP117568:c2258475-2258161 [Escherichia albertii]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14983.36 Da Isoelectric Point: 4.3697
>AT271434 WP_256878813.1 NZ_CP117568:c2258164-2257748 [Escherichia albertii]
MIAIADILQAGEKLTDVAPFLAGIQSEEQYAQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMVQAMSGG
VAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLNGKRKLTLEHAKKLAARFGISPALFID
MIAIADILQAGEKLTDVAPFLAGIQSEEQYAQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMVQAMSGG
VAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLNGKRKLTLEHAKKLAARFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|