Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1856634..1856879 | Replicon | chromosome |
Accession | NZ_CP117568 | ||
Organism | Escherichia albertii strain BIA_5-2 |
Toxin (Protein)
Gene name | hokX | Uniprot ID | L4J2K8 |
Locus tag | PS053_RS09085 | Protein ID | WP_000956460.1 |
Coordinates | 1856634..1856786 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokX | ||
Locus tag | - | ||
Coordinates | 1856831..1856879 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS053_RS09060 | 1851902..1852225 | - | 324 | WP_001246114.1 | DUF3561 family protein | - |
PS053_RS09065 | 1852275..1852880 | - | 606 | WP_256878896.1 | adenylyl-sulfate kinase | - |
PS053_RS09070 | 1852880..1854307 | - | 1428 | WP_054412002.1 | sulfate adenylyltransferase subunit CysN | - |
PS053_RS09075 | 1854309..1855217 | - | 909 | WP_000372392.1 | sulfate adenylyltransferase subunit CysD | - |
PS053_RS09080 | 1855471..1856508 | + | 1038 | WP_256878880.1 | alkaline phosphatase isozyme conversion aminopeptidase | - |
PS053_RS09085 | 1856634..1856786 | - | 153 | WP_000956460.1 | Hok/Gef family protein | Toxin |
- | 1856831..1856879 | + | 49 | - | - | Antitoxin |
PS053_RS09090 | 1857050..1857784 | - | 735 | WP_059216810.1 | phosphoadenosine phosphosulfate reductase | - |
PS053_RS09095 | 1857964..1859676 | - | 1713 | WP_273774864.1 | assimilatory sulfite reductase (NADPH) hemoprotein subunit | - |
PS053_RS09100 | 1859676..1861475 | - | 1800 | WP_256878879.1 | NADPH-dependent assimilatory sulfite reductase flavoprotein subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5602.81 Da Isoelectric Point: 7.7899
>T271432 WP_000956460.1 NZ_CP117568:c1856786-1856634 [Escherichia albertii]
MLTKYALVAIIVLCFTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
MLTKYALVAIIVLCFTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
Download Length: 153 bp
Antitoxin
Download Length: 49 bp
>AT271432 NZ_CP117568:1856831-1856879 [Escherichia albertii]
GTTCGAACGTAGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
GTTCGAACGTAGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|