Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1816222..1816949 | Replicon | chromosome |
Accession | NZ_CP117568 | ||
Organism | Escherichia albertii strain BIA_5-2 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q3YYE6 |
Locus tag | PS053_RS08865 | Protein ID | WP_000547563.1 |
Coordinates | 1816638..1816949 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PS053_RS08860 | Protein ID | WP_000126297.1 |
Coordinates | 1816222..1816641 (-) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS053_RS08845 (1812341) | 1812341..1814593 | - | 2253 | WP_256878885.1 | carbamoyltransferase HypF | - |
PS053_RS08850 (1814746) | 1814746..1815273 | - | 528 | WP_001078780.1 | electron transport protein HydN | - |
PS053_RS08855 (1815702) | 1815702..1816130 | + | 429 | WP_000536064.1 | hypothetical protein | - |
PS053_RS08860 (1816222) | 1816222..1816641 | - | 420 | WP_000126297.1 | helix-turn-helix domain-containing protein | Antitoxin |
PS053_RS08865 (1816638) | 1816638..1816949 | - | 312 | WP_000547563.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
PS053_RS08870 (1817111) | 1817111..1817866 | - | 756 | WP_125060797.1 | hypothetical protein | - |
PS053_RS08875 (1817909) | 1817909..1818379 | - | 471 | WP_059219259.1 | hydrogenase maturation peptidase HycI | - |
PS053_RS08880 (1818372) | 1818372..1818782 | - | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
PS053_RS08885 (1818779) | 1818779..1819546 | - | 768 | WP_059214453.1 | formate hydrogenlyase subunit HycG | - |
PS053_RS08890 (1819546) | 1819546..1820088 | - | 543 | WP_000493797.1 | formate hydrogenlyase subunit HycF | - |
PS053_RS08895 (1820098) | 1820098..1821807 | - | 1710 | WP_256921794.1 | formate hydrogenlyase subunit HycE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12398.11 Da Isoelectric Point: 9.7105
>T271431 WP_000547563.1 NZ_CP117568:c1816949-1816638 [Escherichia albertii]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15446.45 Da Isoelectric Point: 4.4596
>AT271431 WP_000126297.1 NZ_CP117568:c1816641-1816222 [Escherichia albertii]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLTSRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLTSRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|