Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 129187..129451 Replicon plasmid pEA7_1
Accession NZ_CP117563
Organism Escherichia albertii strain BIA_7

Toxin (Protein)


Gene name pndA Uniprot ID A0A8H9BDR8
Locus tag PS049_RS25260 Protein ID WP_023156060.1
Coordinates 129299..129451 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 129187..129247 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS049_RS25245 (124309) 124309..125520 - 1212 WP_179727494.1 DsbC family protein -
PS049_RS25250 (125586) 125586..126779 - 1194 WP_053285742.1 hypothetical protein -
PS049_RS25255 (126795) 126795..129008 - 2214 WP_113078420.1 type IA DNA topoisomerase -
- (129187) 129187..129247 - 61 NuclAT_0 - Antitoxin
- (129187) 129187..129247 - 61 NuclAT_0 - Antitoxin
- (129187) 129187..129247 - 61 NuclAT_0 - Antitoxin
- (129187) 129187..129247 - 61 NuclAT_0 - Antitoxin
PS049_RS25260 (129299) 129299..129451 + 153 WP_023156060.1 Hok/Gef family protein Toxin
PS049_RS25265 (129523) 129523..129774 - 252 WP_001685192.1 hypothetical protein -
PS049_RS25270 (130089) 130089..130184 + 96 WP_000609149.1 DinQ-like type I toxin DqlB -
PS049_RS25275 (130290) 130290..131240 - 951 WP_129442756.1 hypothetical protein -
PS049_RS25280 (131309) 131309..133453 - 2145 WP_273820440.1 DotA/TraY family protein -
PS049_RS25285 (133488) 133488..133712 - 225 WP_050869039.1 hypothetical protein -
PS049_RS25290 (133715) 133715..134278 - 564 WP_019842541.1 conjugal transfer protein TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - efa1 1..177310 177310


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5809.14 Da        Isoelectric Point: 8.7948

>T271416 WP_023156060.1 NZ_CP117563:129299-129451 [Escherichia albertii]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGFRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 61 bp

>AT271416 NZ_CP117563:c129247-129187 [Escherichia albertii]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References