Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hokW-symR/- |
| Location | 3967521..3967746 | Replicon | chromosome |
| Accession | NZ_CP117562 | ||
| Organism | Escherichia albertii strain BIA_7 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A7L6L988 |
| Locus tag | PS049_RS19550 | Protein ID | WP_000813269.1 |
| Coordinates | 3967521..3967676 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | symR | ||
| Locus tag | - | ||
| Coordinates | 3967688..3967746 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS049_RS19500 | 3962536..3962796 | + | 261 | WP_001557934.1 | hypothetical protein | - |
| PS049_RS19505 | 3962960..3963295 | - | 336 | Protein_3797 | YdfR family protein | - |
| PS049_RS19510 | 3963300..3963515 | - | 216 | WP_000839578.1 | class II holin family protein | - |
| PS049_RS19525 | 3964315..3965133 | - | 819 | WP_273819882.1 | CPBP family intramembrane metalloprotease | - |
| PS049_RS19530 | 3965276..3965644 | - | 369 | WP_059217965.1 | antiterminator Q family protein | - |
| PS049_RS19535 | 3965637..3966014 | - | 378 | WP_137654455.1 | RusA family crossover junction endodeoxyribonuclease | - |
| PS049_RS19540 | 3966015..3967073 | - | 1059 | WP_262932784.1 | DUF968 domain-containing protein | - |
| PS049_RS19545 | 3967075..3967353 | - | 279 | WP_059274263.1 | hypothetical protein | - |
| PS049_RS19550 | 3967521..3967676 | - | 156 | WP_000813269.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 3967688..3967746 | + | 59 | - | - | Antitoxin |
| PS049_RS19555 | 3968216..3968413 | - | 198 | Protein_3805 | DUF551 domain-containing protein | - |
| PS049_RS19560 | 3968560..3968967 | - | 408 | WP_137654438.1 | hypothetical protein | - |
| PS049_RS19565 | 3969126..3969542 | - | 417 | WP_273819883.1 | DUF977 family protein | - |
| PS049_RS19570 | 3969550..3970311 | - | 762 | WP_273819884.1 | DUF1627 domain-containing protein | - |
| PS049_RS19575 | 3970334..3971080 | - | 747 | WP_059222314.1 | ATP-binding protein | - |
| PS049_RS19580 | 3971087..3972049 | - | 963 | WP_273819885.1 | helix-turn-helix domain-containing protein | - |
| PS049_RS19585 | 3972073..3972498 | - | 426 | WP_059245556.1 | toxin YdaT family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3936783..3992031 | 55248 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T271410 WP_000813269.1 NZ_CP117562:c3967676-3967521 [Escherichia albertii]
MKQQKAMLVALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLVALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT271410 NZ_CP117562:3967688-3967746 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|