Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hokW-symR/-
Location 3967521..3967746 Replicon chromosome
Accession NZ_CP117562
Organism Escherichia albertii strain BIA_7

Toxin (Protein)


Gene name hokW Uniprot ID A0A7L6L988
Locus tag PS049_RS19550 Protein ID WP_000813269.1
Coordinates 3967521..3967676 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name symR
Locus tag -
Coordinates 3967688..3967746 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS049_RS19500 3962536..3962796 + 261 WP_001557934.1 hypothetical protein -
PS049_RS19505 3962960..3963295 - 336 Protein_3797 YdfR family protein -
PS049_RS19510 3963300..3963515 - 216 WP_000839578.1 class II holin family protein -
PS049_RS19525 3964315..3965133 - 819 WP_273819882.1 CPBP family intramembrane metalloprotease -
PS049_RS19530 3965276..3965644 - 369 WP_059217965.1 antiterminator Q family protein -
PS049_RS19535 3965637..3966014 - 378 WP_137654455.1 RusA family crossover junction endodeoxyribonuclease -
PS049_RS19540 3966015..3967073 - 1059 WP_262932784.1 DUF968 domain-containing protein -
PS049_RS19545 3967075..3967353 - 279 WP_059274263.1 hypothetical protein -
PS049_RS19550 3967521..3967676 - 156 WP_000813269.1 type I toxin-antitoxin system toxin HokD Toxin
- 3967688..3967746 + 59 - - Antitoxin
PS049_RS19555 3968216..3968413 - 198 Protein_3805 DUF551 domain-containing protein -
PS049_RS19560 3968560..3968967 - 408 WP_137654438.1 hypothetical protein -
PS049_RS19565 3969126..3969542 - 417 WP_273819883.1 DUF977 family protein -
PS049_RS19570 3969550..3970311 - 762 WP_273819884.1 DUF1627 domain-containing protein -
PS049_RS19575 3970334..3971080 - 747 WP_059222314.1 ATP-binding protein -
PS049_RS19580 3971087..3972049 - 963 WP_273819885.1 helix-turn-helix domain-containing protein -
PS049_RS19585 3972073..3972498 - 426 WP_059245556.1 toxin YdaT family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3936783..3992031 55248


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5722.86 Da        Isoelectric Point: 6.1531

>T271410 WP_000813269.1 NZ_CP117562:c3967676-3967521 [Escherichia albertii]
MKQQKAMLVALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT271410 NZ_CP117562:3967688-3967746 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7L6L988

Antitoxin

Download structure file

References