Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1835529..1836256 | Replicon | chromosome |
| Accession | NZ_CP117562 | ||
| Organism | Escherichia albertii strain BIA_7 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9ZMR4 |
| Locus tag | PS049_RS08920 | Protein ID | WP_000550189.1 |
| Coordinates | 1835529..1835843 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PS049_RS08925 | Protein ID | WP_000560272.1 |
| Coordinates | 1835840..1836256 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS049_RS08900 (1831688) | 1831688..1832674 | - | 987 | WP_000617693.1 | Gfo/Idh/MocA family oxidoreductase | - |
| PS049_RS08905 (1832753) | 1832753..1833445 | - | 693 | WP_000942533.1 | vancomycin high temperature exclusion protein | - |
| PS049_RS08910 (1833522) | 1833522..1834025 | - | 504 | WP_131109781.1 | M48 family metallopeptidase | - |
| PS049_RS08915 (1834110) | 1834110..1835246 | + | 1137 | WP_273782898.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
| PS049_RS08920 (1835529) | 1835529..1835843 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| PS049_RS08925 (1835840) | 1835840..1836256 | + | 417 | WP_000560272.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| PS049_RS08930 (1836346) | 1836346..1838364 | - | 2019 | WP_273782900.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
| PS049_RS08935 (1838706) | 1838706..1841057 | - | 2352 | WP_273820204.1 | alpha-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T271400 WP_000550189.1 NZ_CP117562:1835529-1835843 [Escherichia albertii]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14993.40 Da Isoelectric Point: 4.3697
>AT271400 WP_000560272.1 NZ_CP117562:1835840-1836256 [Escherichia albertii]
MIAIADILQAGEKLTDVAPFLAGIQSEEQYAQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMVQAMPGG
VAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLNGKRKLTLEHAKKLAARFGISPALFID
MIAIADILQAGEKLTDVAPFLAGIQSEEQYAQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMVQAMPGG
VAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLNGKRKLTLEHAKKLAARFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|