Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 1793943..1794742 | Replicon | chromosome |
| Accession | NZ_CP117562 | ||
| Organism | Escherichia albertii strain BIA_7 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | - |
| Locus tag | PS049_RS08715 | Protein ID | WP_059271009.1 |
| Coordinates | 1793943..1794407 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1PPV5 |
| Locus tag | PS049_RS08720 | Protein ID | WP_001296435.1 |
| Coordinates | 1794407..1794742 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS049_RS08685 (1789005) | 1789005..1789439 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| PS049_RS08690 (1789457) | 1789457..1790335 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| PS049_RS08695 (1790325) | 1790325..1791104 | - | 780 | WP_000406226.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| PS049_RS08700 (1791115) | 1791115..1791588 | - | 474 | WP_059218168.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| PS049_RS08705 (1791611) | 1791611..1792812 | - | 1202 | Protein_1686 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| PS049_RS08710 (1793079) | 1793079..1793888 | + | 810 | WP_000072169.1 | aga operon transcriptional regulator AgaR | - |
| PS049_RS08715 (1793943) | 1793943..1794407 | - | 465 | WP_059271009.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| PS049_RS08720 (1794407) | 1794407..1794742 | - | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| PS049_RS08725 (1794891) | 1794891..1796462 | - | 1572 | WP_273820197.1 | galactarate dehydratase | - |
| PS049_RS08730 (1796833) | 1796833..1798167 | + | 1335 | WP_025238277.1 | galactarate/glucarate/glycerate transporter GarP | - |
| PS049_RS08735 (1798183) | 1798183..1798953 | + | 771 | WP_025238278.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17835.26 Da Isoelectric Point: 9.6804
>T271399 WP_059271009.1 NZ_CP117562:c1794407-1793943 [Escherichia albertii]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTQETEEKH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTQETEEKH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|