Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 1440305..1441017 | Replicon | chromosome |
Accession | NZ_CP117562 | ||
Organism | Escherichia albertii strain BIA_7 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A7U8WCQ7 |
Locus tag | PS049_RS06865 | Protein ID | WP_000162413.1 |
Coordinates | 1440715..1441017 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PS049_RS06860 | Protein ID | WP_000806446.1 |
Coordinates | 1440305..1440643 (-) | Length | 113 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS049_RS06835 (1435360) | 1435360..1437342 | + | 1983 | WP_107193138.1 | TonB-dependent heme/hemoglobin receptor ChuA/ShuA | - |
PS049_RS06840 (1437391) | 1437391..1438419 | + | 1029 | WP_001110409.1 | hematinate-forming heme oxygenase ChuS | - |
PS049_RS06845 (1438491) | 1438491..1439021 | - | 531 | WP_000480294.1 | LuxR C-terminal-related transcriptional regulator | - |
PS049_RS06850 (1439168) | 1439168..1439734 | - | 567 | WP_001044206.1 | outer membrane lipoprotein Slp | - |
PS049_RS06855 (1440081) | 1440081..1440248 | - | 168 | WP_273782721.1 | hypothetical protein | - |
PS049_RS06860 (1440305) | 1440305..1440643 | - | 339 | WP_000806446.1 | HigA family addiction module antitoxin | Antitoxin |
PS049_RS06865 (1440715) | 1440715..1441017 | - | 303 | WP_000162413.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PS049_RS06870 (1441181) | 1441181..1441660 | + | 480 | WP_273782723.1 | hypothetical protein | - |
PS049_RS06875 (1441750) | 1441750..1441923 | - | 174 | WP_000553433.1 | hypothetical protein | - |
PS049_RS06880 (1441951) | 1441951..1442034 | + | 84 | WP_001295215.1 | damage-inducible type I toxin DinQ | - |
PS049_RS06885 (1442088) | 1442088..1443440 | - | 1353 | WP_273782725.1 | glutathione-disulfide reductase | - |
PS049_RS06890 (1443512) | 1443512..1444354 | - | 843 | WP_000954227.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11871.59 Da Isoelectric Point: 9.8664
>T271397 WP_000162413.1 NZ_CP117562:c1441017-1440715 [Escherichia albertii]
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLDPHKY
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLDPHKY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|