Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 1361110..1361367 Replicon chromosome
Accession NZ_CP117562
Organism Escherichia albertii strain BIA_7

Toxin (Protein)


Gene name hokA Uniprot ID V0YDF1
Locus tag PS049_RS06515 Protein ID WP_001135738.1
Coordinates 1361215..1361367 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name sokA
Locus tag -
Coordinates 1361110..1361164 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS049_RS06495 1356339..1357334 - 996 WP_001182625.1 acyltransferase -
PS049_RS06500 1357507..1357806 + 300 WP_000979961.1 YsaB family lipoprotein -
PS049_RS06505 1357902..1358813 + 912 WP_001168544.1 glycine--tRNA ligase subunit alpha -
PS049_RS06510 1358823..1360892 + 2070 WP_001291807.1 glycine--tRNA ligase subunit beta -
- 1361110..1361164 - 55 - - Antitoxin
PS049_RS06515 1361215..1361367 + 153 WP_001135738.1 type I toxin-antitoxin system toxin HokA Toxin
PS049_RS06520 1361344..1361415 - 72 WP_212734940.1 hypothetical protein -
PS049_RS06525 1361555..1361767 - 213 WP_000014594.1 RNA chaperone/antiterminator CspA -
PS049_RS06530 1362050..1362340 - 291 WP_000455794.1 HTH-type transcriptional regulator -
PS049_RS06535 1362763..1363473 + 711 WP_002460072.1 DUF3053 domain-containing protein -
PS049_RS06540 1363526..1364500 - 975 WP_000804993.1 glyoxylate/hydroxypyruvate reductase GhrB -
PS049_RS06545 1364604..1365263 - 660 WP_000747625.1 OmpA family lipoprotein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(5-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5912.14 Da        Isoelectric Point: 7.7173

>T271396 WP_001135738.1 NZ_CP117562:1361215-1361367 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE

Download         Length: 153 bp

Antitoxin


Download         Length: 55 bp

>AT271396 NZ_CP117562:c1361164-1361110 [Escherichia albertii]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LX93

Antitoxin

Download structure file

References