Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HTH(antitoxin)
Location 991115..991717 Replicon chromosome
Accession NZ_CP117562
Organism Escherichia albertii strain BIA_7

Toxin (Protein)


Gene name higB Uniprot ID S1P416
Locus tag PS049_RS04765 Protein ID WP_000897302.1
Coordinates 991406..991717 (-) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag PS049_RS04760 Protein ID WP_000356397.1
Coordinates 991115..991405 (-) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS049_RS04720 (986525) 986525..987427 + 903 WP_000331386.1 formate dehydrogenase O subunit beta -
PS049_RS04725 (987424) 987424..988059 + 636 WP_000829019.1 formate dehydrogenase cytochrome b556 subunit -
PS049_RS04730 (988056) 988056..988985 + 930 WP_000027704.1 formate dehydrogenase accessory protein FdhE -
PS049_RS04735 (989022) 989022..989386 - 365 Protein_919 type II toxin-antitoxin system VapC family toxin -
PS049_RS04740 (989386) 989386..989628 - 243 WP_001275524.1 CopG family transcriptional regulator -
PS049_RS04745 (989845) 989845..990063 - 219 WP_001251292.1 CopG family transcriptional regulator -
PS049_RS04750 (990478) 990478..990756 - 279 WP_001296612.1 hypothetical protein -
PS049_RS04755 (990818) 990818..991030 - 213 WP_000197774.1 hypothetical protein -
PS049_RS04760 (991115) 991115..991405 - 291 WP_000356397.1 NadS family protein Antitoxin
PS049_RS04765 (991406) 991406..991717 - 312 WP_000897302.1 hypothetical protein Toxin
PS049_RS04770 (991946) 991946..992854 + 909 WP_273782542.1 alpha/beta hydrolase -
PS049_RS04775 (992918) 992918..993859 - 942 WP_001297068.1 fatty acid biosynthesis protein FabY -
PS049_RS04780 (993904) 993904..994341 - 438 WP_000560979.1 D-aminoacyl-tRNA deacylase -
PS049_RS04785 (994338) 994338..995210 - 873 WP_273782543.1 virulence factor BrkB family protein -
PS049_RS04790 (995204) 995204..995803 - 600 WP_273820109.1 glucose-1-phosphatase -
PS049_RS04795 (995902) 995902..996687 - 786 WP_000059671.1 DeoR/GlpR family DNA-binding transcription regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(36-85)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12203.19 Da        Isoelectric Point: 9.7791

>T271395 WP_000897302.1 NZ_CP117562:c991717-991406 [Escherichia albertii]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW

Download         Length: 312 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10846.43 Da        Isoelectric Point: 10.8907

>AT271395 WP_000356397.1 NZ_CP117562:c991405-991115 [Escherichia albertii]
MDKALFERLTHSMAQMNEIIEGTRQPSRTFEVDAMKIKEIRRASGLSQSKFADLISVSVDTLRNWEQGRRSPTGPAKALL
RAIANDPQHVLQALNR

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1P416

Antitoxin

Source ID Structure

References