Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symE-sokW/SymE(toxin) |
Location | 480154..480567 | Replicon | chromosome |
Accession | NZ_CP117562 | ||
Organism | Escherichia albertii strain BIA_7 |
Toxin (Protein)
Gene name | symE | Uniprot ID | A0A8D9PK47 |
Locus tag | PS049_RS02350 | Protein ID | WP_000132619.1 |
Coordinates | 480226..480567 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 480154..480231 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS049_RS02340 (477056) | 477056..478645 | + | 1590 | WP_059216569.1 | type I restriction-modification system methyltransferase | - |
PS049_RS02345 (478642) | 478642..479997 | + | 1356 | WP_059216570.1 | restriction endonuclease subunit S | - |
- (480154) | 480154..480231 | - | 78 | NuclAT_10 | - | Antitoxin |
- (480154) | 480154..480231 | - | 78 | NuclAT_10 | - | Antitoxin |
- (480154) | 480154..480231 | - | 78 | NuclAT_10 | - | Antitoxin |
- (480154) | 480154..480231 | - | 78 | NuclAT_10 | - | Antitoxin |
- (480154) | 480154..480231 | - | 78 | NuclAT_9 | - | Antitoxin |
- (480154) | 480154..480231 | - | 78 | NuclAT_9 | - | Antitoxin |
- (480154) | 480154..480231 | - | 78 | NuclAT_9 | - | Antitoxin |
- (480154) | 480154..480231 | - | 78 | NuclAT_9 | - | Antitoxin |
PS049_RS02350 (480226) | 480226..480567 | + | 342 | WP_000132619.1 | endoribonuclease SymE | Toxin |
PS049_RS02355 (480729) | 480729..482108 | + | 1380 | WP_273820056.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
PS049_RS02360 (482108) | 482108..483154 | + | 1047 | WP_015953744.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
PS049_RS02365 (483210) | 483210..484288 | - | 1079 | Protein_461 | DUF1998 domain-containing protein | - |
PS049_RS02370 (484603) | 484603..485535 | - | 933 | WP_273782440.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12322.13 Da Isoelectric Point: 7.8219
>T271390 WP_000132619.1 NZ_CP117562:480226-480567 [Escherichia albertii]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAPEESE
LMQSLRQVCKLSARKQKQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAPEESE
LMQSLRQVCKLSARKQKQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 78 bp
>AT271390 NZ_CP117562:c480231-480154 [Escherichia albertii]
AGTCATAACTGCTATTCCTTGGAAAATAGTGATTGTGATGATCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCTTGGAAAATAGTGATTGTGATGATCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|