Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 75370..75634 Replicon plasmid pEA8_2
Accession NZ_CP117560
Organism Escherichia albertii strain BIA_8

Toxin (Protein)


Gene name pndA Uniprot ID E6BRV3
Locus tag PS052_RS24220 Protein ID WP_001303307.1
Coordinates 75482..75634 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 75370..75432 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS052_RS24205 (70609) 70609..72900 - 2292 WP_072255563.1 F-type conjugative transfer protein TrbC -
PS052_RS24210 (72893) 72893..73963 - 1071 WP_273765794.1 IncI1-type conjugal transfer protein TrbB -
PS052_RS24215 (73982) 73982..75190 - 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
- (75370) 75370..75432 - 63 NuclAT_0 - Antitoxin
- (75370) 75370..75432 - 63 NuclAT_0 - Antitoxin
- (75370) 75370..75432 - 63 NuclAT_0 - Antitoxin
- (75370) 75370..75432 - 63 NuclAT_0 - Antitoxin
PS052_RS24220 (75482) 75482..75634 + 153 WP_001303307.1 Hok/Gef family protein Toxin
PS052_RS24225 (75706) 75706..75957 - 252 WP_001291965.1 hypothetical protein -
PS052_RS24230 (76456) 76456..76551 + 96 WP_001303310.1 DinQ-like type I toxin DqlB -
PS052_RS24235 (76616) 76616..76792 - 177 WP_001054897.1 hypothetical protein -
PS052_RS24245 (78100) 78100..79035 - 936 Protein_89 secretin N-terminal domain-containing protein -
PS052_RS24250 (79049) 79049..79486 - 438 WP_000539807.1 type IV pilus biogenesis protein PilM -
PS052_RS24255 (79486) 79486..80552 - 1067 Protein_91 type IV pilus biogenesis lipoprotein PilL -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..91469 91469


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5817.21 Da        Isoelectric Point: 8.7948

>T271385 WP_001303307.1 NZ_CP117560:75482-75634 [Escherichia albertii]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 63 bp

>AT271385 NZ_CP117560:c75432-75370 [Escherichia albertii]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A634Q5L1

Antitoxin

Download structure file

References