Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symE-OrzO/SymE(toxin) |
Location | 4019560..4019972 | Replicon | chromosome |
Accession | NZ_CP117558 | ||
Organism | Escherichia albertii strain BIA_8 |
Toxin (Protein)
Gene name | symE | Uniprot ID | A0A8D9PK47 |
Locus tag | PS052_RS19890 | Protein ID | WP_000132619.1 |
Coordinates | 4019631..4019972 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | OrzO | ||
Locus tag | - | ||
Coordinates | 4019560..4019636 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS052_RS19870 (4015422) | 4015422..4015913 | + | 492 | Protein_3889 | type I restriction-modification system subunit M N-terminal domain-containing protein | - |
PS052_RS19875 (4015969) | 4015969..4016666 | + | 698 | WP_094096600.1 | IS1-like element IS1A family transposase | - |
PS052_RS19880 (4016682) | 4016682..4017668 | + | 987 | Protein_3891 | N-6 DNA methylase | - |
PS052_RS19885 (4017668) | 4017668..4019410 | + | 1743 | WP_103054261.1 | restriction endonuclease subunit S | - |
- (4019560) | 4019560..4019636 | - | 77 | NuclAT_8 | - | Antitoxin |
- (4019560) | 4019560..4019636 | - | 77 | NuclAT_8 | - | Antitoxin |
- (4019560) | 4019560..4019636 | - | 77 | NuclAT_8 | - | Antitoxin |
- (4019560) | 4019560..4019636 | - | 77 | NuclAT_8 | - | Antitoxin |
- (4019560) | 4019560..4019636 | - | 77 | NuclAT_9 | - | Antitoxin |
- (4019560) | 4019560..4019636 | - | 77 | NuclAT_9 | - | Antitoxin |
- (4019560) | 4019560..4019636 | - | 77 | NuclAT_9 | - | Antitoxin |
- (4019560) | 4019560..4019636 | - | 77 | NuclAT_9 | - | Antitoxin |
PS052_RS19890 (4019631) | 4019631..4019972 | + | 342 | WP_000132619.1 | endoribonuclease SymE | Toxin |
PS052_RS19895 (4020134) | 4020134..4021512 | + | 1379 | Protein_3894 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
PS052_RS19900 (4021512) | 4021512..4022558 | + | 1047 | WP_072252312.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
PS052_RS19905 (4022614) | 4022614..4023692 | - | 1079 | Protein_3896 | DUF1998 domain-containing protein | - |
PS052_RS19910 (4024007) | 4024007..4024938 | - | 932 | Protein_3897 | Rpn family recombination-promoting nuclease/putative transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4011814..4035965 | 24151 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12322.13 Da Isoelectric Point: 7.8219
>T271377 WP_000132619.1 NZ_CP117558:4019631-4019972 [Escherichia albertii]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAPEESE
LMQSLRQVCKLSARKQKQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAPEESE
LMQSLRQVCKLSARKQKQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT271377 NZ_CP117558:c4019636-4019560 [Escherichia albertii]
AGTCATAACTGCTATTCTCCGATAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCGATAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|