Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2873652..2873877 | Replicon | chromosome |
| Accession | NZ_CP117558 | ||
| Organism | Escherichia albertii strain BIA_8 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | PS052_RS14310 | Protein ID | WP_000813254.1 |
| Coordinates | 2873652..2873807 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2873819..2873877 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS052_RS14280 | 2868692..2869435 | - | 744 | Protein_2801 | DUF968 domain-containing protein | - |
| PS052_RS14285 | 2869537..2870709 | + | 1173 | WP_053264206.1 | IS21-like element IS21 family transposase | - |
| PS052_RS14290 | 2870709..2871506 | + | 798 | WP_273764657.1 | IS21-like element IS21 family helper ATPase IstB | - |
| PS052_RS14295 | 2871564..2871881 | - | 318 | Protein_2804 | hypothetical protein | - |
| PS052_RS14300 | 2871883..2872161 | - | 279 | WP_033870554.1 | hypothetical protein | - |
| PS052_RS14305 | 2872346..2873554 | - | 1209 | WP_000343728.1 | IS256-like element IS1414 family transposase | - |
| PS052_RS14310 | 2873652..2873807 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 2873819..2873877 | + | 59 | - | - | Antitoxin |
| PS052_RS14315 | 2874352..2875029 | - | 678 | WP_244510491.1 | hypothetical protein | - |
| PS052_RS14320 | 2875030..2875161 | - | 132 | Protein_2809 | hypothetical protein | - |
| PS052_RS14325 | 2875158..2875367 | - | 210 | WP_000951707.1 | hypothetical protein | - |
| PS052_RS14330 | 2875369..2875926 | - | 558 | WP_000014353.1 | ead/Ea22-like family protein | - |
| PS052_RS14335 | 2875923..2876099 | - | 177 | WP_000753067.1 | hypothetical protein | - |
| PS052_RS14340 | 2876092..2876274 | - | 183 | WP_001224672.1 | hypothetical protein | - |
| PS052_RS14345 | 2876423..2876845 | - | 423 | WP_001151248.1 | DUF977 family protein | - |
| PS052_RS14350 | 2876886..2877962 | - | 1077 | WP_001262417.1 | hypothetical protein | - |
| PS052_RS14355 | 2878034..2878459 | - | 426 | WP_000693841.1 | toxin YdaT family protein | - |
| PS052_RS14360 | 2878456..2878722 | - | 267 | WP_074404412.1 | YdaS family helix-turn-helix protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2842700..2887079 | 44379 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T271373 WP_000813254.1 NZ_CP117558:c2873807-2873652 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT271373 NZ_CP117558:2873819-2873877 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
