Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1030440..1030685 | Replicon | chromosome |
Accession | NZ_CP117558 | ||
Organism | Escherichia albertii strain BIA_8 |
Toxin (Protein)
Gene name | hokX | Uniprot ID | L4J2K8 |
Locus tag | PS052_RS04995 | Protein ID | WP_000956460.1 |
Coordinates | 1030533..1030685 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokX | ||
Locus tag | - | ||
Coordinates | 1030440..1030488 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS052_RS04980 | 1025939..1027738 | + | 1800 | WP_103053841.1 | NADPH-dependent assimilatory sulfite reductase flavoprotein subunit | - |
PS052_RS04985 | 1027738..1029450 | + | 1713 | WP_103053840.1 | assimilatory sulfite reductase (NADPH) hemoprotein subunit | - |
PS052_RS04990 | 1029535..1030269 | + | 735 | WP_059228192.1 | phosphoadenosine phosphosulfate reductase | - |
- | 1030440..1030488 | - | 49 | - | - | Antitoxin |
PS052_RS04995 | 1030533..1030685 | + | 153 | WP_000956460.1 | Hok/Gef family protein | Toxin |
PS052_RS05000 | 1030849..1031961 | - | 1113 | WP_059228194.1 | IS4-like element IS421 family transposase | - |
PS052_RS05005 | 1032214..1034871 | + | 2658 | WP_123057910.1 | CRISPR-associated helicase Cas3' | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1030849..1031961 | 1112 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5602.81 Da Isoelectric Point: 7.7899
>T271367 WP_000956460.1 NZ_CP117558:1030533-1030685 [Escherichia albertii]
MLTKYALVAIIVLCFTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
MLTKYALVAIIVLCFTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
Download Length: 153 bp
Antitoxin
Download Length: 49 bp
>AT271367 NZ_CP117558:c1030488-1030440 [Escherichia albertii]
GTTCGAACGTAGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
GTTCGAACGTAGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|