Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 618448..619175 | Replicon | chromosome |
| Accession | NZ_CP117558 | ||
| Organism | Escherichia albertii strain BIA_8 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9ZMR4 |
| Locus tag | PS052_RS03110 | Protein ID | WP_000550189.1 |
| Coordinates | 618448..618762 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PS052_RS03115 | Protein ID | WP_103053950.1 |
| Coordinates | 618759..619175 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS052_RS03090 (614607) | 614607..615593 | - | 987 | WP_103053951.1 | Gfo/Idh/MocA family oxidoreductase | - |
| PS052_RS03095 (615672) | 615672..616364 | - | 693 | WP_025238291.1 | vancomycin high temperature exclusion protein | - |
| PS052_RS03100 (616441) | 616441..616944 | - | 504 | WP_044709508.1 | M48 family metallopeptidase | - |
| PS052_RS03105 (617029) | 617029..618165 | + | 1137 | WP_059241776.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
| PS052_RS03110 (618448) | 618448..618762 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| PS052_RS03115 (618759) | 618759..619175 | + | 417 | WP_103053950.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| PS052_RS03120 (619265) | 619265..621283 | - | 2019 | WP_103053949.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
| PS052_RS03125 (621726) | 621726..624077 | - | 2352 | WP_000695424.1 | alpha-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T271365 WP_000550189.1 NZ_CP117558:618448-618762 [Escherichia albertii]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15019.44 Da Isoelectric Point: 4.2698
>AT271365 WP_103053950.1 NZ_CP117558:618759-619175 [Escherichia albertii]
MIAIADILQAGEKLTDVAPFLAGIQSEEQYAQALELVDYLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMVQAMPGG
VAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLNGKRKLTLEHAKKLAARFGISPALFID
MIAIADILQAGEKLTDVAPFLAGIQSEEQYAQALELVDYLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMVQAMPGG
VAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLNGKRKLTLEHAKKLAARFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|