Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 576164..576963 | Replicon | chromosome |
Accession | NZ_CP117558 | ||
Organism | Escherichia albertii strain BIA_8 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | A0A8H9C2I0 |
Locus tag | PS052_RS02895 | Protein ID | WP_059227548.1 |
Coordinates | 576164..576628 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | - |
Locus tag | PS052_RS02900 | Protein ID | WP_103053959.1 |
Coordinates | 576628..576963 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS052_RS02865 (571165) | 571165..571599 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
PS052_RS02870 (571617) | 571617..572495 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
PS052_RS02875 (572485) | 572485..573264 | - | 780 | WP_000406226.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
PS052_RS02880 (573275) | 573275..573748 | - | 474 | WP_002461030.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
PS052_RS02885 (573771) | 573771..575051 | - | 1281 | WP_059227551.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
PS052_RS02890 (575300) | 575300..576109 | + | 810 | WP_103053960.1 | aga operon transcriptional regulator AgaR | - |
PS052_RS02895 (576164) | 576164..576628 | - | 465 | WP_059227548.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
PS052_RS02900 (576628) | 576628..576963 | - | 336 | WP_103053959.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
PS052_RS02905 (577112) | 577112..578683 | - | 1572 | WP_103053958.1 | galactarate dehydratase | - |
PS052_RS02910 (579054) | 579054..580388 | + | 1335 | WP_025238277.1 | galactarate/glucarate/glycerate transporter GarP | - |
PS052_RS02915 (580404) | 580404..581174 | + | 771 | WP_059235438.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17819.26 Da Isoelectric Point: 9.7301
>T271364 WP_059227548.1 NZ_CP117558:c576628-576164 [Escherichia albertii]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRFRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTQETEEKH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRFRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTQETEEKH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|