Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 228898..229610 | Replicon | chromosome |
| Accession | NZ_CP117558 | ||
| Organism | Escherichia albertii strain BIA_8 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A8D9ULK1 |
| Locus tag | PS052_RS01060 | Protein ID | WP_059257620.1 |
| Coordinates | 229308..229610 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PS052_RS01055 | Protein ID | WP_000806446.1 |
| Coordinates | 228898..229236 (-) | Length | 113 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS052_RS01030 (223949) | 223949..225931 | + | 1983 | WP_103054026.1 | TonB-dependent heme/hemoglobin receptor ChuA/ShuA | - |
| PS052_RS01035 (225980) | 225980..227008 | + | 1029 | WP_103054025.1 | hematinate-forming heme oxygenase ChuS | - |
| PS052_RS01040 (227080) | 227080..227610 | - | 531 | WP_000480294.1 | LuxR C-terminal-related transcriptional regulator | - |
| PS052_RS01045 (227757) | 227757..228323 | - | 567 | WP_001044206.1 | outer membrane lipoprotein Slp | - |
| PS052_RS01050 (228670) | 228670..228807 | - | 138 | WP_199768253.1 | hypothetical protein | - |
| PS052_RS01055 (228898) | 228898..229236 | - | 339 | WP_000806446.1 | HigA family addiction module antitoxin | Antitoxin |
| PS052_RS01060 (229308) | 229308..229610 | - | 303 | WP_059257620.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PS052_RS01065 (229774) | 229774..230253 | + | 480 | WP_103054024.1 | hypothetical protein | - |
| PS052_RS01070 (230343) | 230343..230516 | - | 174 | WP_000553433.1 | hypothetical protein | - |
| PS052_RS01075 (230544) | 230544..230627 | + | 84 | WP_001295215.1 | damage-inducible type I toxin DinQ | - |
| PS052_RS01080 (230681) | 230681..232033 | - | 1353 | WP_059225142.1 | glutathione-disulfide reductase | - |
| PS052_RS01085 (232105) | 232105..232947 | - | 843 | WP_000954227.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11843.53 Da Isoelectric Point: 9.8664
>T271362 WP_059257620.1 NZ_CP117558:c229610-229308 [Escherichia albertii]
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWANGKAEDLYLDPHKY
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWANGKAEDLYLDPHKY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|