Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 149858..150115 | Replicon | chromosome |
Accession | NZ_CP117558 | ||
Organism | Escherichia albertii strain BIA_8 |
Toxin (Protein)
Gene name | hokA | Uniprot ID | A0A8D9PLG9 |
Locus tag | PS052_RS00710 | Protein ID | WP_069913754.1 |
Coordinates | 149963..150115 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokA | ||
Locus tag | - | ||
Coordinates | 149858..149906 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS052_RS00690 | 145087..146082 | - | 996 | WP_103054035.1 | acyltransferase | - |
PS052_RS00695 | 146255..146554 | + | 300 | WP_000979961.1 | YsaB family lipoprotein | - |
PS052_RS00700 | 146650..147561 | + | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
PS052_RS00705 | 147571..149640 | + | 2070 | WP_103054034.1 | glycine--tRNA ligase subunit beta | - |
- | 149858..149906 | - | 49 | - | - | Antitoxin |
PS052_RS00710 | 149963..150115 | + | 153 | WP_069913754.1 | type I toxin-antitoxin system toxin HokA | Toxin |
PS052_RS00715 | 150092..150163 | - | 72 | WP_212734940.1 | hypothetical protein | - |
PS052_RS00720 | 150303..150515 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
PS052_RS00725 | 150798..151088 | - | 291 | WP_000455794.1 | HTH-type transcriptional regulator | - |
PS052_RS00730 | 151511..152221 | + | 711 | WP_002460072.1 | DUF3053 domain-containing protein | - |
PS052_RS00735 | 152274..153248 | - | 975 | WP_000804993.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
PS052_RS00740 | 153352..154011 | - | 660 | WP_000747625.1 | OmpA family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5940.19 Da Isoelectric Point: 7.7173
>T271361 WP_069913754.1 NZ_CP117558:149963-150115 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAVFLACNLKE
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAVFLACNLKE
Download Length: 153 bp
Antitoxin
Download Length: 49 bp
>AT271361 NZ_CP117558:c149906-149858 [Escherichia albertii]
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|