Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 35937..36206 | Replicon | plasmid pEA89-5_1 |
| Accession | NZ_CP117557 | ||
| Organism | Escherichia albertii strain BIA_89-5 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | PS032_RS25855 | Protein ID | WP_001372321.1 |
| Coordinates | 36081..36206 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 35937..36002 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS032_RS25810 | 30975..31398 | - | 424 | Protein_36 | hypothetical protein | - |
| PS032_RS25815 | 31468..31674 | + | 207 | WP_000547944.1 | hypothetical protein | - |
| PS032_RS25820 | 31700..32236 | + | 537 | WP_000290806.1 | single-stranded DNA-binding protein | - |
| PS032_RS25825 | 32294..32527 | + | 234 | WP_053272376.1 | DUF905 domain-containing protein | - |
| PS032_RS25830 | 32591..34549 | + | 1959 | WP_137650591.1 | ParB/RepB/Spo0J family partition protein | - |
| PS032_RS25835 | 34618..35052 | + | 435 | WP_089572216.1 | conjugation system SOS inhibitor PsiB | - |
| PS032_RS25840 | 35049..35811 | + | 763 | Protein_42 | plasmid SOS inhibition protein A | - |
| PS032_RS25845 | 35780..35968 | - | 189 | WP_157904642.1 | protein sok | - |
| - | 35780..36004 | + | 225 | NuclAT_0 | - | - |
| - | 35780..36004 | + | 225 | NuclAT_0 | - | - |
| - | 35780..36004 | + | 225 | NuclAT_0 | - | - |
| - | 35780..36004 | + | 225 | NuclAT_0 | - | - |
| - | 35937..36002 | - | 66 | - | - | Antitoxin |
| PS032_RS25850 | 35990..36139 | + | 150 | Protein_44 | plasmid maintenance protein Mok | - |
| PS032_RS25855 | 36081..36206 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| PS032_RS25860 | 36427..36657 | + | 231 | WP_001426396.1 | hypothetical protein | - |
| PS032_RS25865 | 36655..36827 | - | 173 | Protein_47 | hypothetical protein | - |
| PS032_RS25870 | 36897..37103 | + | 207 | WP_089644688.1 | single-stranded DNA-binding protein | - |
| PS032_RS25875 | 37127..37423 | + | 297 | WP_273807102.1 | hypothetical protein | - |
| PS032_RS25880 | 37678..38112 | + | 435 | WP_122989639.1 | transposase | - |
| PS032_RS25885 | 38109..38459 | + | 351 | WP_089572268.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| PS032_RS25890 | 38490..40082 | + | 1593 | WP_137650637.1 | IS66 family transposase | - |
| PS032_RS25895 | 40075..41039 | + | 965 | Protein_53 | plasmid segregation protein ParM | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..75610 | 75610 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T271359 WP_001372321.1 NZ_CP117557:36081-36206 [Escherichia albertii]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT271359 NZ_CP117557:c36002-35937 [Escherichia albertii]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|