Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4277907..4278165 | Replicon | chromosome |
| Accession | NZ_CP117556 | ||
| Organism | Escherichia albertii strain BIA_89-5 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | PS032_RS21500 | Protein ID | WP_000809168.1 |
| Coordinates | 4278013..4278165 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 4277907..4277964 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS032_RS21485 | 4273715..4274962 | - | 1248 | WP_059227922.1 | hypothetical protein | - |
| PS032_RS21490 | 4275116..4276609 | - | 1494 | WP_137649571.1 | sulfatase-like hydrolase/transferase | - |
| PS032_RS21495 | 4276630..4277391 | - | 762 | WP_001276205.1 | outer membrane protein OmpK | - |
| - | 4277907..4277964 | - | 58 | - | - | Antitoxin |
| PS032_RS21500 | 4278013..4278165 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| PS032_RS21505 | 4278269..4279399 | - | 1131 | WP_001118445.1 | molecular chaperone DnaJ | - |
| PS032_RS21510 | 4279488..4281404 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
| PS032_RS21515 | 4281779..4282183 | + | 405 | WP_000833520.1 | DUF2541 family protein | - |
| PS032_RS21520 | 4282210..4282923 | + | 714 | WP_001102345.1 | acidic protein MsyB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T271351 WP_000809168.1 NZ_CP117556:4278013-4278165 [Escherichia albertii]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT271351 NZ_CP117556:c4277964-4277907 [Escherichia albertii]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|