Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2491451..2492013 | Replicon | chromosome |
Accession | NZ_CP117556 | ||
Organism | Escherichia albertii strain BIA_89-5 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1Q1V8 |
Locus tag | PS032_RS12455 | Protein ID | WP_000605675.1 |
Coordinates | 2491735..2492013 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1PAQ1 |
Locus tag | PS032_RS12450 | Protein ID | WP_000781370.1 |
Coordinates | 2491451..2491735 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS032_RS12435 (2486810) | 2486810..2489857 | + | 3048 | WP_137650311.1 | formate dehydrogenase-N subunit alpha | - |
PS032_RS12440 (2489870) | 2489870..2490754 | + | 885 | WP_137650310.1 | formate dehydrogenase N subunit beta | - |
PS032_RS12445 (2490747) | 2490747..2491400 | + | 654 | WP_000045646.1 | formate dehydrogenase-N subunit gamma | - |
PS032_RS12450 (2491451) | 2491451..2491735 | - | 285 | WP_000781370.1 | HigA family addiction module antitoxin | Antitoxin |
PS032_RS12455 (2491735) | 2491735..2492013 | - | 279 | WP_000605675.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PS032_RS12460 (2492199) | 2492199..2493209 | - | 1011 | WP_000642385.1 | alcohol dehydrogenase AdhP | - |
PS032_RS12465 (2493344) | 2493344..2495041 | - | 1698 | WP_107192708.1 | malate dehydrogenase | - |
PS032_RS12470 (2495198) | 2495198..2495335 | - | 138 | WP_000841563.1 | stationary-phase-induced ribosome-associated protein | - |
PS032_RS12475 (2495602) | 2495602..2496033 | + | 432 | WP_137650309.1 | peroxiredoxin OsmC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10537.16 Da Isoelectric Point: 7.3206
>T271345 WP_000605675.1 NZ_CP117556:c2492013-2491735 [Escherichia albertii]
MIMNFRHKGLRDLFLLGKTSGVIPTQVKRLRHRLAVIDAACCLADIDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
MIMNFRHKGLRDLFLLGKTSGVIPTQVKRLRHRLAVIDAACCLADIDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1Q1V8 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 2ICT | |
PDB | 2ICP | |
AlphaFold DB | A0A829CUG6 |