Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ralRA/- |
Location | 2356220..2356591 | Replicon | chromosome |
Accession | NZ_CP117556 | ||
Organism | Escherichia albertii strain BIA_89-5 |
Toxin (Protein)
Gene name | ralR | Uniprot ID | - |
Locus tag | PS032_RS11730 | Protein ID | WP_137650428.1 |
Coordinates | 2356397..2356591 (-) | Length | 65 a.a. |
Antitoxin (RNA)
Gene name | ralA | ||
Locus tag | - | ||
Coordinates | 2356220..2356398 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS032_RS11700 (2351998) | 2351998..2352171 | + | 174 | WP_032275239.1 | protein YnaL | - |
PS032_RS11705 (2352201) | 2352201..2353574 | + | 1374 | WP_137650219.1 | ATP-dependent RNA helicase DbpA | - |
PS032_RS11710 (2353677) | 2353677..2354612 | - | 936 | WP_059228647.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
PS032_RS11715 (2354664) | 2354664..2355899 | - | 1236 | WP_137653527.1 | site-specific integrase | - |
PS032_RS11720 (2355901) | 2355901..2356116 | - | 216 | WP_000079604.1 | excisionase XisR | - |
- (2356220) | 2356220..2356398 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2356220) | 2356220..2356398 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2356220) | 2356220..2356398 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2356220) | 2356220..2356398 | + | 179 | NuclAT_0 | - | Antitoxin |
PS032_RS11725 (2356195) | 2356195..2356404 | - | 210 | WP_000276809.1 | double-strand break reduction protein RcbA | - |
PS032_RS11730 (2356397) | 2356397..2356591 | - | 195 | WP_137650428.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
PS032_RS11735 (2356648) | 2356648..2357457 | - | 810 | WP_000166319.1 | recombination protein RecT | - |
PS032_RS11740 (2357450) | 2357450..2360083 | - | 2634 | WP_137650429.1 | exodeoxyribonuclease VIII | - |
PS032_RS11745 (2360185) | 2360185..2360460 | - | 276 | WP_044805262.1 | hypothetical protein | - |
PS032_RS11750 (2360596) | 2360596..2360817 | - | 222 | WP_062898151.1 | cell division protein FtsZ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2354664..2398461 | 43797 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7094.98 Da Isoelectric Point: 8.9329
>T271341 WP_137650428.1 NZ_CP117556:c2356591-2356397 [Escherichia albertii]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCEYRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCEYRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT271341 NZ_CP117556:2356220-2356398 [Escherichia albertii]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|