Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 620283..621082 | Replicon | chromosome |
| Accession | NZ_CP117556 | ||
| Organism | Escherichia albertii strain BIA_89-5 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | S1NYM6 |
| Locus tag | PS032_RS03160 | Protein ID | WP_000347251.1 |
| Coordinates | 620283..620747 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1PPV5 |
| Locus tag | PS032_RS03165 | Protein ID | WP_001296435.1 |
| Coordinates | 620747..621082 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS032_RS03130 (615284) | 615284..615718 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| PS032_RS03135 (615736) | 615736..616614 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| PS032_RS03140 (616604) | 616604..617383 | - | 780 | WP_000406226.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| PS032_RS03145 (617394) | 617394..617867 | - | 474 | WP_137649678.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| PS032_RS03150 (617890) | 617890..619170 | - | 1281 | WP_059227551.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| PS032_RS03155 (619419) | 619419..620228 | + | 810 | WP_103053960.1 | aga operon transcriptional regulator AgaR | - |
| PS032_RS03160 (620283) | 620283..620747 | - | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| PS032_RS03165 (620747) | 620747..621082 | - | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| PS032_RS03170 (621231) | 621231..622802 | - | 1572 | WP_059218167.1 | galactarate dehydratase | - |
| PS032_RS03175 (623173) | 623173..624507 | + | 1335 | WP_000599659.1 | galactarate/glucarate/glycerate transporter GarP | - |
| PS032_RS03180 (624523) | 624523..625293 | + | 771 | WP_025238278.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T271333 WP_000347251.1 NZ_CP117556:c620747-620283 [Escherichia albertii]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJ20 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1PPV5 |