Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 235459..236171 | Replicon | chromosome |
| Accession | NZ_CP117556 | ||
| Organism | Escherichia albertii strain BIA_89-5 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7U8WCQ7 |
| Locus tag | PS032_RS01075 | Protein ID | WP_000162413.1 |
| Coordinates | 235869..236171 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PS032_RS01070 | Protein ID | WP_000806447.1 |
| Coordinates | 235459..235797 (-) | Length | 113 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS032_RS01045 (230502) | 230502..232484 | + | 1983 | WP_000089601.1 | TonB-dependent heme/hemoglobin receptor ChuA/ShuA | - |
| PS032_RS01050 (232533) | 232533..233561 | + | 1029 | WP_001110408.1 | hematinate-forming heme oxygenase ChuS | - |
| PS032_RS01055 (233633) | 233633..234163 | - | 531 | WP_000480294.1 | LuxR C-terminal-related transcriptional regulator | - |
| PS032_RS01060 (234310) | 234310..234876 | - | 567 | WP_001044206.1 | outer membrane lipoprotein Slp | - |
| PS032_RS01065 (235223) | 235223..235402 | - | 180 | WP_002460167.1 | hypothetical protein | - |
| PS032_RS01070 (235459) | 235459..235797 | - | 339 | WP_000806447.1 | HigA family addiction module antitoxin | Antitoxin |
| PS032_RS01075 (235869) | 235869..236171 | - | 303 | WP_000162413.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PS032_RS01080 (236335) | 236335..236814 | + | 480 | WP_107193136.1 | hypothetical protein | - |
| PS032_RS01085 (236827) | 236827..237909 | - | 1083 | WP_265463928.1 | IS481 family transposase | - |
| PS032_RS01090 (238005) | 238005..238178 | - | 174 | WP_000553433.1 | hypothetical protein | - |
| PS032_RS01095 (238206) | 238206..238289 | + | 84 | WP_001295215.1 | damage-inducible type I toxin DinQ | - |
| PS032_RS01100 (238343) | 238343..239695 | - | 1353 | WP_000160823.1 | glutathione-disulfide reductase | - |
| PS032_RS01105 (239767) | 239767..240609 | - | 843 | WP_000954227.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 236827..237909 | 1082 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11871.59 Da Isoelectric Point: 9.8664
>T271330 WP_000162413.1 NZ_CP117556:c236171-235869 [Escherichia albertii]
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLDPHKY
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLDPHKY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|