Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 5920853..5921448 | Replicon | chromosome |
Accession | NZ_CP117527 | ||
Organism | Pseudomonas aeruginosa strain MF1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | PSP57_RS27895 | Protein ID | WP_003113526.1 |
Coordinates | 5921170..5921448 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A0S3KUN4 |
Locus tag | PSP57_RS27890 | Protein ID | WP_003111575.1 |
Coordinates | 5920853..5921158 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PSP57_RS27875 (PSP57_27875) | 5917564..5918427 | - | 864 | WP_023098850.1 | integrase domain-containing protein | - |
PSP57_RS27880 (PSP57_27880) | 5919028..5920170 | - | 1143 | WP_023098851.1 | STY4528 family pathogenicity island replication protein | - |
PSP57_RS27890 (PSP57_27890) | 5920853..5921158 | - | 306 | WP_003111575.1 | HigA family addiction module antitoxin | Antitoxin |
PSP57_RS27895 (PSP57_27895) | 5921170..5921448 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PSP57_RS27900 (PSP57_27900) | 5921501..5921629 | - | 129 | Protein_5516 | integrase | - |
PSP57_RS27905 (PSP57_27905) | 5921777..5924005 | + | 2229 | WP_021264080.1 | TonB-dependent receptor | - |
PSP57_RS27910 (PSP57_27910) | 5924075..5924722 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
PSP57_RS27915 (PSP57_27915) | 5924784..5926022 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T271320 WP_003113526.1 NZ_CP117527:c5921448-5921170 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V6ALY3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3KUN4 |