Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2797738..2798067 | Replicon | chromosome |
Accession | NZ_CP117508 | ||
Organism | Enterococcus faecalis strain CQJXZ21-077 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | A0A3N3Z2N6 |
Locus tag | PSC78_RS13685 | Protein ID | WP_073340360.1 |
Coordinates | 2797738..2797878 (+) | Length | 47 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2798018..2798067 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PSC78_RS13665 | 2792952..2793944 | + | 993 | WP_002354765.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
PSC78_RS13670 | 2794208..2794804 | - | 597 | WP_002414968.1 | lytic polysaccharide monooxygenase | - |
PSC78_RS13675 | 2795530..2797146 | + | 1617 | WP_104681241.1 | phosphatase PAP2/LCP family protein | - |
PSC78_RS13680 | 2797476..2797619 | + | 144 | WP_002392818.1 | type I toxin-antitoxin system toxin PepG1 | - |
PSC78_RS13685 | 2797738..2797878 | + | 141 | WP_073340360.1 | putative holin-like toxin | Toxin |
- | 2798018..2798067 | + | 50 | - | - | Antitoxin |
PSC78_RS13690 | 2798069..2801065 | - | 2997 | WP_002385134.1 | WxL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 47 a.a. Molecular weight: 5218.33 Da Isoelectric Point: 10.3265
>T271284 WP_073340360.1 NZ_CP117508:2797738-2797878 [Enterococcus faecalis]
ISLKNTNKNIVYCTTYETIQTILGFGMFTIALIALIVKLLKNDKKK
ISLKNTNKNIVYCTTYETIQTILGFGMFTIALIALIVKLLKNDKKK
Download Length: 141 bp
Antitoxin
Download Length: 50 bp
>AT271284 NZ_CP117508:2798018-2798067 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|