Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-RNAII/- |
| Location | 313103..313297 | Replicon | chromosome |
| Accession | NZ_CP117503 | ||
| Organism | Enterococcus faecalis strain CQJXZ21-076 | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | PSC77_RS01565 | Protein ID | WP_015543884.1 |
| Coordinates | 313202..313297 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 313103..313167 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PSC77_RS01550 (308736) | 308736..310478 | + | 1743 | WP_010709199.1 | PTS transporter subunit EIIC | - |
| PSC77_RS01555 (310469) | 310469..312502 | + | 2034 | WP_002361171.1 | PRD domain-containing protein | - |
| PSC77_RS01560 (312513) | 312513..312947 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
| - (313103) | 313103..313167 | + | 65 | NuclAT_9 | - | Antitoxin |
| PSC77_RS01565 (313202) | 313202..313297 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| PSC77_RS01570 (313543) | 313543..315315 | + | 1773 | WP_002389635.1 | PTS mannitol-specific transporter subunit IIBC | - |
| PSC77_RS01575 (315330) | 315330..315767 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
| PSC77_RS01580 (315782) | 315782..316936 | + | 1155 | WP_010709200.1 | mannitol-1-phosphate 5-dehydrogenase | - |
| PSC77_RS01585 (317005) | 317005..318120 | - | 1116 | WP_010709201.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T271246 WP_015543884.1 NZ_CP117503:c313297-313202 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT271246 NZ_CP117503:313103-313167 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|