Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 336053..336639 Replicon chromosome
Accession NZ_CP117481
Organism Klebsiella pneumoniae strain DS-1

Toxin (Protein)


Gene name doc Uniprot ID A0A486RB10
Locus tag PPH92_RS01570 Protein ID WP_004174007.1
Coordinates 336271..336639 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag PPH92_RS01565 Protein ID WP_004174006.1
Coordinates 336053..336274 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PPH92_RS01545 (332210) 332210..333136 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PPH92_RS01550 (333133) 333133..334410 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
PPH92_RS01555 (334407) 334407..335174 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PPH92_RS01560 (335176) 335176..335889 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
PPH92_RS01565 (336053) 336053..336274 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PPH92_RS01570 (336271) 336271..336639 + 369 WP_004174007.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PPH92_RS01575 (336912) 336912..338228 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
PPH92_RS01580 (338335) 338335..339222 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
PPH92_RS01585 (339219) 339219..340064 + 846 WP_004185988.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
PPH92_RS01590 (340066) 340066..341136 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 333133..341873 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(6-116)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13568.97 Da        Isoelectric Point: 8.6410

>T271228 WP_004174007.1 NZ_CP117481:336271-336639 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDLGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT271228 WP_004174006.1 NZ_CP117481:336053-336274 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A486RB10

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References