Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4655888..4656642 | Replicon | chromosome |
| Accession | NZ_CP117404 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain RM085 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | PQQ07_RS22565 | Protein ID | WP_000558166.1 |
| Coordinates | 4655888..4656199 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PQQ07_RS22570 | Protein ID | WP_001259011.1 |
| Coordinates | 4656196..4656642 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ07_RS22535 (4651546) | 4651546..4652448 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| PQQ07_RS22540 (4652445) | 4652445..4653080 | + | 636 | WP_274896181.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PQQ07_RS22545 (4653077) | 4653077..4654006 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| PQQ07_RS22550 (4654053) | 4654053..4654343 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| PQQ07_RS22555 (4654344) | 4654344..4654655 | - | 312 | WP_001159634.1 | hypothetical protein | - |
| PQQ07_RS22560 (4654873) | 4654873..4655802 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
| PQQ07_RS22565 (4655888) | 4655888..4656199 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PQQ07_RS22570 (4656196) | 4656196..4656642 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PQQ07_RS22575 (4656657) | 4656657..4657598 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PQQ07_RS22580 (4657643) | 4657643..4658080 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| PQQ07_RS22585 (4658077) | 4658077..4658949 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
| PQQ07_RS22590 (4658943) | 4658943..4659542 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| PQQ07_RS22595 (4659733) | 4659733..4660536 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PQQ07_RS22600 (4660570) | 4660570..4661466 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T271210 WP_000558166.1 NZ_CP117404:4655888-4656199 [Salmonella enterica subsp. enterica serovar Typhimurium]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT271210 WP_001259011.1 NZ_CP117404:4656196-4656642 [Salmonella enterica subsp. enterica serovar Typhimurium]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|