Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 4332950..4333731 | Replicon | chromosome |
| Accession | NZ_CP117404 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain RM085 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | E8X9W8 |
| Locus tag | PQQ07_RS21125 | Protein ID | WP_000626099.1 |
| Coordinates | 4332950..4333441 (-) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | B5R979 |
| Locus tag | PQQ07_RS21130 | Protein ID | WP_001110452.1 |
| Coordinates | 4333438..4333731 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ07_RS21090 (4328170) | 4328170..4328565 | + | 396 | WP_000208386.1 | DUF6088 family protein | - |
| PQQ07_RS21095 (4328558) | 4328558..4329505 | + | 948 | WP_001440173.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| PQQ07_RS21100 (4329791) | 4329791..4329868 | - | 78 | Protein_4123 | helix-turn-helix domain-containing protein | - |
| PQQ07_RS21105 (4329959) | 4329959..4330291 | - | 333 | WP_001165471.1 | MerR family transcriptional regulator | - |
| PQQ07_RS21110 (4330363) | 4330363..4330740 | + | 378 | WP_000916345.1 | EthD family reductase | - |
| PQQ07_RS21115 (4331773) | 4331773..4331847 | + | 75 | Protein_4126 | porin family protein | - |
| PQQ07_RS21120 (4331950) | 4331950..4332702 | + | 753 | WP_000842434.1 | non-specific acid phosphatase | - |
| PQQ07_RS21125 (4332950) | 4332950..4333441 | - | 492 | WP_000626099.1 | GNAT family N-acetyltransferase | Toxin |
| PQQ07_RS21130 (4333438) | 4333438..4333731 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
| PQQ07_RS21135 (4334048) | 4334048..4334269 | + | 222 | WP_001576552.1 | hypothetical protein | - |
| PQQ07_RS21140 (4334534) | 4334534..4335409 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
| PQQ07_RS21145 (4335406) | 4335406..4335693 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
| PQQ07_RS21150 (4335716) | 4335716..4335931 | + | 216 | WP_001595136.1 | hypothetical protein | - |
| PQQ07_RS21155 (4335939) | 4335939..4336208 | + | 270 | WP_010989096.1 | hypothetical protein | - |
| PQQ07_RS21160 (4336417) | 4336417..4336875 | - | 459 | WP_000502119.1 | IS200/IS605-like element IS200F family transposase | - |
| PQQ07_RS21165 (4337214) | 4337214..4338119 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | floR | - | 4300626..4336875 | 36249 | |
| flank | IS/Tn | - | - | 4336417..4336875 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17646.39 Da Isoelectric Point: 6.8437
>T271208 WP_000626099.1 NZ_CP117404:c4333441-4332950 [Salmonella enterica subsp. enterica serovar Typhimurium]
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10977.61 Da Isoelectric Point: 8.6141
>AT271208 WP_001110452.1 NZ_CP117404:c4333731-4333438 [Salmonella enterica subsp. enterica serovar Typhimurium]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7AK7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7AK7 | |
| AlphaFold DB | A0A5I1DGA4 |