Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4395711..4396492 | Replicon | chromosome |
Accession | NZ_CP117400 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain RM014 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | E8X9W8 |
Locus tag | PQP96_RS21625 | Protein ID | WP_000626099.1 |
Coordinates | 4395711..4396202 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | PQP96_RS21630 | Protein ID | WP_001110452.1 |
Coordinates | 4396199..4396492 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP96_RS21590 (4391706) | 4391706..4392281 | + | 576 | WP_001188509.1 | transcriptional regulator | - |
PQP96_RS21600 (4392552) | 4392552..4392629 | - | 78 | Protein_4221 | helix-turn-helix domain-containing protein | - |
PQP96_RS21605 (4392720) | 4392720..4393052 | - | 333 | WP_001165471.1 | MerR family transcriptional regulator | - |
PQP96_RS21610 (4393124) | 4393124..4393501 | + | 378 | WP_000916345.1 | EthD family reductase | - |
PQP96_RS21615 (4394534) | 4394534..4394608 | + | 75 | Protein_4224 | porin family protein | - |
PQP96_RS21620 (4394711) | 4394711..4395463 | + | 753 | WP_000842434.1 | non-specific acid phosphatase | - |
PQP96_RS21625 (4395711) | 4395711..4396202 | - | 492 | WP_000626099.1 | GNAT family N-acetyltransferase | Toxin |
PQP96_RS21630 (4396199) | 4396199..4396492 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
PQP96_RS21635 (4396809) | 4396809..4397030 | + | 222 | WP_001576552.1 | hypothetical protein | - |
PQP96_RS21640 (4397295) | 4397295..4398170 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
PQP96_RS21645 (4398167) | 4398167..4398454 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
PQP96_RS21650 (4398477) | 4398477..4398692 | + | 216 | WP_001595136.1 | hypothetical protein | - |
PQP96_RS21655 (4398700) | 4398700..4398969 | + | 270 | WP_010989096.1 | hypothetical protein | - |
PQP96_RS21660 (4399178) | 4399178..4399636 | - | 459 | WP_000502119.1 | IS200/IS605-like element IS200F family transposase | - |
PQP96_RS21665 (4399975) | 4399975..4400880 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 4399178..4399636 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17646.39 Da Isoelectric Point: 6.8437
>T271173 WP_000626099.1 NZ_CP117400:c4396202-4395711 [Salmonella enterica subsp. enterica serovar Typhimurium]
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10977.61 Da Isoelectric Point: 8.6141
>AT271173 WP_001110452.1 NZ_CP117400:c4396492-4396199 [Salmonella enterica subsp. enterica serovar Typhimurium]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 | |
AlphaFold DB | A0A5I1DGA4 |