Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2475165..2475687 | Replicon | chromosome |
Accession | NZ_CP117400 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain RM014 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | PQP96_RS12170 | Protein ID | WP_000221343.1 |
Coordinates | 2475403..2475687 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | PQP96_RS12165 | Protein ID | WP_000885424.1 |
Coordinates | 2475165..2475413 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP96_RS12140 (2470381) | 2470381..2471847 | + | 1467 | WP_000987828.1 | hypothetical protein | - |
PQP96_RS12145 (2472655) | 2472655..2473369 | + | 715 | Protein_2376 | helix-turn-helix domain-containing protein | - |
PQP96_RS12150 (2473425) | 2473425..2474333 | - | 909 | WP_010989018.1 | hypothetical protein | - |
PQP96_RS12155 (2474476) | 2474476..2474808 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
PQP96_RS12160 (2474798) | 2474798..2475013 | - | 216 | WP_000206207.1 | hypothetical protein | - |
PQP96_RS12165 (2475165) | 2475165..2475413 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PQP96_RS12170 (2475403) | 2475403..2475687 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PQP96_RS12175 (2475858) | 2475858..2476247 | + | 390 | WP_000194089.1 | RidA family protein | - |
PQP96_RS12180 (2476299) | 2476299..2477378 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
PQP96_RS12185 (2477571) | 2477571..2478059 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
PQP96_RS12190 (2478104) | 2478104..2479612 | + | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2470384..2482469 | 12085 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T271167 WP_000221343.1 NZ_CP117400:2475403-2475687 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |