Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 13609..14266 | Replicon | plasmid pRM015_1 |
Accession | NZ_CP117399 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain RM015 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U3PDC3 |
Locus tag | PQQ09_RS24135 | Protein ID | WP_000270043.1 |
Coordinates | 13916..14266 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PQQ09_RS24130 | Protein ID | WP_000124640.1 |
Coordinates | 13609..13911 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ09_RS24085 (PQQ09_24085) | 9234..9662 | + | 429 | WP_000591074.1 | hypothetical protein | - |
PQQ09_RS24090 (PQQ09_24090) | 9719..10078 | + | 360 | WP_000422768.1 | hypothetical protein | - |
PQQ09_RS24095 (PQQ09_24095) | 10078..10524 | + | 447 | WP_000919345.1 | Fe3+-siderophore ABC transporter permease | - |
PQQ09_RS24100 (PQQ09_24100) | 10521..11039 | + | 519 | WP_000210756.1 | nitrite reductase | - |
PQQ09_RS24105 (PQQ09_24105) | 11039..11269 | + | 231 | WP_000972663.1 | hypothetical protein | - |
PQQ09_RS24110 (PQQ09_24110) | 11256..12113 | + | 858 | WP_001167032.1 | hypothetical protein | - |
PQQ09_RS24115 (PQQ09_24115) | 12344..12871 | + | 528 | WP_001236377.1 | thermonuclease family protein | - |
PQQ09_RS24120 (PQQ09_24120) | 12929..13201 | + | 273 | WP_001043047.1 | HU family DNA-binding protein | - |
PQQ09_RS24125 (PQQ09_24125) | 13289..13582 | + | 294 | WP_001239997.1 | chromosome segregation protein ParM | - |
PQQ09_RS24130 (PQQ09_24130) | 13609..13911 | - | 303 | WP_000124640.1 | XRE family transcriptional regulator | Antitoxin |
PQQ09_RS24135 (PQQ09_24135) | 13916..14266 | - | 351 | WP_000270043.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PQQ09_RS24140 (PQQ09_24140) | 14429..14977 | + | 549 | WP_001061574.1 | transcriptional regulator | - |
PQQ09_RS24145 (PQQ09_24145) | 15318..15512 | + | 195 | WP_000343597.1 | hypothetical protein | - |
PQQ09_RS24150 (PQQ09_24150) | 15523..15894 | + | 372 | WP_000516916.1 | hypothetical protein | - |
PQQ09_RS24155 (PQQ09_24155) | 15887..16357 | + | 471 | WP_001281821.1 | hypothetical protein | - |
PQQ09_RS24160 (PQQ09_24160) | 16372..16707 | - | 336 | WP_000683476.1 | hypothetical protein | - |
PQQ09_RS24165 (PQQ09_24165) | 16804..17292 | + | 489 | WP_001273096.1 | DUF1643 domain-containing protein | - |
PQQ09_RS24170 (PQQ09_24170) | 17295..17792 | + | 498 | WP_000062185.1 | hypothetical protein | - |
PQQ09_RS24175 (PQQ09_24175) | 18007..18711 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | - | 1..54292 | 54292 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13328.21 Da Isoelectric Point: 5.2421
>T271156 WP_000270043.1 NZ_CP117399:c14266-13916 [Salmonella enterica subsp. enterica serovar Typhimurium]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
Download Length: 351 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11006.73 Da Isoelectric Point: 7.2036
>AT271156 WP_000124640.1 NZ_CP117399:c13911-13609 [Salmonella enterica subsp. enterica serovar Typhimurium]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|