Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4718561..4719315 | Replicon | chromosome |
| Accession | NZ_CP117398 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain RM015 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | PQQ09_RS23065 | Protein ID | WP_000558166.1 |
| Coordinates | 4718561..4718872 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PQQ09_RS23070 | Protein ID | WP_001259011.1 |
| Coordinates | 4718869..4719315 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ09_RS23035 (4714219) | 4714219..4715121 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| PQQ09_RS23040 (4715118) | 4715118..4715753 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PQQ09_RS23045 (4715750) | 4715750..4716679 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| PQQ09_RS23050 (4716726) | 4716726..4717016 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| PQQ09_RS23055 (4717017) | 4717017..4717328 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| PQQ09_RS23060 (4717546) | 4717546..4718475 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
| PQQ09_RS23065 (4718561) | 4718561..4718872 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PQQ09_RS23070 (4718869) | 4718869..4719315 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PQQ09_RS23075 (4719330) | 4719330..4720271 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PQQ09_RS23080 (4720316) | 4720316..4720753 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| PQQ09_RS23085 (4720750) | 4720750..4721622 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
| PQQ09_RS23090 (4721616) | 4721616..4722215 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| PQQ09_RS23095 (4722406) | 4722406..4723209 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PQQ09_RS23100 (4723243) | 4723243..4724139 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T271155 WP_000558166.1 NZ_CP117398:4718561-4718872 [Salmonella enterica subsp. enterica serovar Typhimurium]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT271155 WP_001259011.1 NZ_CP117398:4718869-4719315 [Salmonella enterica subsp. enterica serovar Typhimurium]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|