Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 4615677..4616431 Replicon chromosome
Accession NZ_CP117396
Organism Salmonella enterica subsp. enterica serovar Uganda strain RM016

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag PQP86_RS22485 Protein ID WP_000558162.1
Coordinates 4615677..4615988 (+) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag PQP86_RS22490 Protein ID WP_001259009.1
Coordinates 4615985..4616431 (+) Length 149 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP86_RS22455 (4611335) 4611335..4612237 + 903 WP_000331364.1 formate dehydrogenase subunit beta -
PQP86_RS22460 (4612234) 4612234..4612869 + 636 WP_000829028.1 formate dehydrogenase cytochrome b556 subunit -
PQP86_RS22465 (4612866) 4612866..4613795 + 930 WP_000027730.1 formate dehydrogenase accessory protein FdhE -
PQP86_RS22470 (4613842) 4613842..4614132 - 291 WP_000362050.1 DNA-binding transcriptional regulator -
PQP86_RS22475 (4614133) 4614133..4614444 - 312 WP_001159635.1 cytotoxic translational repressor of toxin-antitoxin stability system -
PQP86_RS22480 (4614662) 4614662..4615591 + 930 WP_001127706.1 alpha/beta hydrolase -
PQP86_RS22485 (4615677) 4615677..4615988 + 312 WP_000558162.1 type II toxin-antitoxin system HigB family toxin Toxin
PQP86_RS22490 (4615985) 4615985..4616431 + 447 WP_001259009.1 type II toxin-antitoxin system HigA family antitoxin Antitoxin
PQP86_RS22495 (4616446) 4616446..4617387 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
PQP86_RS22500 (4617432) 4617432..4617869 - 438 WP_000560969.1 D-aminoacyl-tRNA deacylase -
PQP86_RS22505 (4617866) 4617866..4618738 - 873 WP_000921423.1 virulence factor BrkB family protein -
PQP86_RS22510 (4618732) 4618732..4619331 - 600 WP_000965695.1 glucose-1-phosphatase -
PQP86_RS22515 (4619522) 4619522..4620325 - 804 WP_000059693.1 DeoR/GlpR family DNA-binding transcription regulator -
PQP86_RS22520 (4620359) 4620359..4621255 - 897 WP_001651900.1 sugar kinase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(21-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(93-146)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12358.28 Da        Isoelectric Point: 9.3143

>T271135 WP_000558162.1 NZ_CP117396:4615677-4615988 [Salmonella enterica subsp. enterica serovar Uganda]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYDRGNKE

Download         Length: 312 bp

Antitoxin


Download         Length: 149 a.a.        Molecular weight: 16720.06 Da        Isoelectric Point: 6.6451

>AT271135 WP_001259009.1 NZ_CP117396:4615985-4616431 [Salmonella enterica subsp. enterica serovar Uganda]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE

Download         Length: 447 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References