Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4613842..4614444 | Replicon | chromosome |
| Accession | NZ_CP117396 | ||
| Organism | Salmonella enterica subsp. enterica serovar Uganda strain RM016 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | M7S4R6 |
| Locus tag | PQP86_RS22475 | Protein ID | WP_001159635.1 |
| Coordinates | 4614133..4614444 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PQP86_RS22470 | Protein ID | WP_000362050.1 |
| Coordinates | 4613842..4614132 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP86_RS22455 (4611335) | 4611335..4612237 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| PQP86_RS22460 (4612234) | 4612234..4612869 | + | 636 | WP_000829028.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PQP86_RS22465 (4612866) | 4612866..4613795 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| PQP86_RS22470 (4613842) | 4613842..4614132 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
| PQP86_RS22475 (4614133) | 4614133..4614444 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
| PQP86_RS22480 (4614662) | 4614662..4615591 | + | 930 | WP_001127706.1 | alpha/beta hydrolase | - |
| PQP86_RS22485 (4615677) | 4615677..4615988 | + | 312 | WP_000558162.1 | type II toxin-antitoxin system HigB family toxin | - |
| PQP86_RS22490 (4615985) | 4615985..4616431 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | - |
| PQP86_RS22495 (4616446) | 4616446..4617387 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PQP86_RS22500 (4617432) | 4617432..4617869 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| PQP86_RS22505 (4617866) | 4617866..4618738 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| PQP86_RS22510 (4618732) | 4618732..4619331 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12340.30 Da Isoelectric Point: 9.4460
>T271134 WP_001159635.1 NZ_CP117396:c4614444-4614133 [Salmonella enterica subsp. enterica serovar Uganda]
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10971.59 Da Isoelectric Point: 10.6525
>AT271134 WP_000362050.1 NZ_CP117396:c4614132-4613842 [Salmonella enterica subsp. enterica serovar Uganda]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|