Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4613757..4614359 | Replicon | chromosome |
Accession | NZ_CP117394 | ||
Organism | Salmonella enterica subsp. enterica serovar Uganda strain RM017 |
Toxin (Protein)
Gene name | higB | Uniprot ID | M7S4R6 |
Locus tag | PQP77_RS22485 | Protein ID | WP_001159635.1 |
Coordinates | 4614048..4614359 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PQP77_RS22480 | Protein ID | WP_000362050.1 |
Coordinates | 4613757..4614047 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP77_RS22465 (4611250) | 4611250..4612152 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
PQP77_RS22470 (4612149) | 4612149..4612784 | + | 636 | WP_000829028.1 | formate dehydrogenase cytochrome b556 subunit | - |
PQP77_RS22475 (4612781) | 4612781..4613710 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
PQP77_RS22480 (4613757) | 4613757..4614047 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
PQP77_RS22485 (4614048) | 4614048..4614359 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
PQP77_RS22490 (4614577) | 4614577..4615506 | + | 930 | WP_001127706.1 | alpha/beta hydrolase | - |
PQP77_RS22495 (4615592) | 4615592..4615903 | + | 312 | WP_000558162.1 | type II toxin-antitoxin system HigB family toxin | - |
PQP77_RS22500 (4615900) | 4615900..4616346 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | - |
PQP77_RS22505 (4616361) | 4616361..4617302 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
PQP77_RS22510 (4617347) | 4617347..4617784 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
PQP77_RS22515 (4617781) | 4617781..4618653 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
PQP77_RS22520 (4618647) | 4618647..4619246 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12340.30 Da Isoelectric Point: 9.4460
>T271112 WP_001159635.1 NZ_CP117394:c4614359-4614048 [Salmonella enterica subsp. enterica serovar Uganda]
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10971.59 Da Isoelectric Point: 10.6525
>AT271112 WP_000362050.1 NZ_CP117394:c4614047-4613757 [Salmonella enterica subsp. enterica serovar Uganda]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|