Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4452970..4453724 | Replicon | chromosome |
| Accession | NZ_CP117392 | ||
| Organism | Salmonella enterica subsp. enterica serovar Give strain RM019 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | PQQ03_RS21635 | Protein ID | WP_000558166.1 |
| Coordinates | 4452970..4453281 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PQQ03_RS21640 | Protein ID | WP_001259009.1 |
| Coordinates | 4453278..4453724 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ03_RS21605 (4448628) | 4448628..4449530 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| PQQ03_RS21610 (4449527) | 4449527..4450162 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PQQ03_RS21615 (4450159) | 4450159..4451088 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| PQQ03_RS21620 (4451135) | 4451135..4451425 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| PQQ03_RS21625 (4451426) | 4451426..4451737 | - | 312 | WP_001159631.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| PQQ03_RS21630 (4451955) | 4451955..4452884 | + | 930 | WP_001127691.1 | alpha/beta hydrolase | - |
| PQQ03_RS21635 (4452970) | 4452970..4453281 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PQQ03_RS21640 (4453278) | 4453278..4453724 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PQQ03_RS21645 (4453739) | 4453739..4454680 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PQQ03_RS21650 (4454725) | 4454725..4455162 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| PQQ03_RS21655 (4455159) | 4455159..4456031 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| PQQ03_RS21660 (4456025) | 4456025..4456624 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| PQQ03_RS21665 (4456815) | 4456815..4457618 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PQQ03_RS21670 (4457652) | 4457652..4458548 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T271092 WP_000558166.1 NZ_CP117392:4452970-4453281 [Salmonella enterica subsp. enterica serovar Give]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT271092 WP_001259009.1 NZ_CP117392:4453278-4453724 [Salmonella enterica subsp. enterica serovar Give]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|