Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 4576153..4576907 Replicon chromosome
Accession NZ_CP117390
Organism Salmonella enterica subsp. enterica serovar Uganda strain RM008

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag PQP88_RS22180 Protein ID WP_000558162.1
Coordinates 4576153..4576464 (+) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag PQP88_RS22185 Protein ID WP_001259009.1
Coordinates 4576461..4576907 (+) Length 149 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP88_RS22150 (4571811) 4571811..4572713 + 903 WP_000331364.1 formate dehydrogenase subunit beta -
PQP88_RS22155 (4572710) 4572710..4573345 + 636 WP_274890473.1 formate dehydrogenase cytochrome b556 subunit -
PQP88_RS22160 (4573342) 4573342..4574271 + 930 WP_000027730.1 formate dehydrogenase accessory protein FdhE -
PQP88_RS22165 (4574318) 4574318..4574608 - 291 WP_000362050.1 DNA-binding transcriptional regulator -
PQP88_RS22170 (4574609) 4574609..4574920 - 312 WP_001159635.1 cytotoxic translational repressor of toxin-antitoxin stability system -
PQP88_RS22175 (4575138) 4575138..4576067 + 930 WP_001127706.1 alpha/beta hydrolase -
PQP88_RS22180 (4576153) 4576153..4576464 + 312 WP_000558162.1 type II toxin-antitoxin system HigB family toxin Toxin
PQP88_RS22185 (4576461) 4576461..4576907 + 447 WP_001259009.1 type II toxin-antitoxin system HigA family antitoxin Antitoxin
PQP88_RS22190 (4576922) 4576922..4577863 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
PQP88_RS22195 (4577908) 4577908..4578345 - 438 WP_000560969.1 D-aminoacyl-tRNA deacylase -
PQP88_RS22200 (4578342) 4578342..4579214 - 873 WP_000921423.1 virulence factor BrkB family protein -
PQP88_RS22205 (4579208) 4579208..4579807 - 600 WP_000965695.1 glucose-1-phosphatase -
PQP88_RS22210 (4579998) 4579998..4580801 - 804 WP_000059693.1 DeoR/GlpR family DNA-binding transcription regulator -
PQP88_RS22215 (4580835) 4580835..4581731 - 897 WP_001651900.1 sugar kinase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(21-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(93-146)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12358.28 Da        Isoelectric Point: 9.3143

>T271078 WP_000558162.1 NZ_CP117390:4576153-4576464 [Salmonella enterica subsp. enterica serovar Uganda]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYDRGNKE

Download         Length: 312 bp

Antitoxin


Download         Length: 149 a.a.        Molecular weight: 16720.06 Da        Isoelectric Point: 6.6451

>AT271078 WP_001259009.1 NZ_CP117390:4576461-4576907 [Salmonella enterica subsp. enterica serovar Uganda]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE

Download         Length: 447 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References