Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 1901326..1901986 | Replicon | chromosome |
| Accession | NZ_CP117390 | ||
| Organism | Salmonella enterica subsp. enterica serovar Uganda strain RM008 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A623V7Z2 |
| Locus tag | PQP88_RS09105 | Protein ID | WP_000269842.1 |
| Coordinates | 1901326..1901679 (+) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PQP88_RS09110 | Protein ID | WP_000533827.1 |
| Coordinates | 1901684..1901986 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP88_RS09080 (1897391) | 1897391..1898146 | + | 756 | WP_001089670.1 | multiubiquitin domain-containing protein | - |
| PQP88_RS09085 (1898121) | 1898121..1899305 | + | 1185 | WP_076741638.1 | ThiF family adenylyltransferase | - |
| PQP88_RS09090 (1899299) | 1899299..1899763 | + | 465 | WP_001660343.1 | DUF6527 family protein | - |
| PQP88_RS09095 (1900144) | 1900144..1900611 | + | 468 | WP_000201266.1 | hypothetical protein | - |
| PQP88_RS09100 (1900608) | 1900608..1900829 | + | 222 | WP_000813787.1 | helix-turn-helix transcriptional regulator | - |
| PQP88_RS09105 (1901326) | 1901326..1901679 | + | 354 | WP_000269842.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQP88_RS09110 (1901684) | 1901684..1901986 | + | 303 | WP_000533827.1 | XRE family transcriptional regulator | Antitoxin |
| PQP88_RS09115 (1902492) | 1902492..1903376 | + | 885 | WP_000511750.1 | integrase domain-containing protein | - |
| PQP88_RS09120 (1904245) | 1904245..1905507 | - | 1263 | WP_076741637.1 | integrase arm-type DNA-binding domain-containing protein | - |
| PQP88_RS09130 (1905845) | 1905845..1906642 | - | 798 | WP_000598920.1 | DgsA anti-repressor MtfA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1882218..1911422 | 29204 | |
| - | inside | Prophage | - | - | 1882218..1914662 | 32444 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13476.36 Da Isoelectric Point: 9.9199
>T271062 WP_000269842.1 NZ_CP117390:1901326-1901679 [Salmonella enterica subsp. enterica serovar Uganda]
VWTIKTTDTFDRWFASLNDTNRVSVLAALLVLREKGPGLSRPYADTVRGSRYSNMKELRIQSRGEPIRAFFAFDPTRTGI
VLCAGNKVGNEKRFYDEMLPVADREFTNWLNTLKEKE
VWTIKTTDTFDRWFASLNDTNRVSVLAALLVLREKGPGLSRPYADTVRGSRYSNMKELRIQSRGEPIRAFFAFDPTRTGI
VLCAGNKVGNEKRFYDEMLPVADREFTNWLNTLKEKE
Download Length: 354 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11040.81 Da Isoelectric Point: 5.7316
>AT271062 WP_000533827.1 NZ_CP117390:1901684-1901986 [Salmonella enterica subsp. enterica serovar Uganda]
MGRTLEQLIADEKPEVVAEAQAMATDILLNIHLAELREKVQKTQVEMAQALGIRQPTVAGMEKPGRDLKLSTLKRYVEAT
GGKLRLDVELPDGSHYGFVL
MGRTLEQLIADEKPEVVAEAQAMATDILLNIHLAELREKVQKTQVEMAQALGIRQPTVAGMEKPGRDLKLSTLKRYVEAT
GGKLRLDVELPDGSHYGFVL
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|