Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 4615698..4616452 Replicon chromosome
Accession NZ_CP117388
Organism Salmonella enterica subsp. enterica serovar Uganda strain RM010

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag PQQ04_RS22495 Protein ID WP_000558162.1
Coordinates 4615698..4616009 (+) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag PQQ04_RS22500 Protein ID WP_001259009.1
Coordinates 4616006..4616452 (+) Length 149 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ04_RS22465 (4611356) 4611356..4612258 + 903 WP_000331364.1 formate dehydrogenase subunit beta -
PQQ04_RS22470 (4612255) 4612255..4612890 + 636 WP_274894956.1 formate dehydrogenase cytochrome b556 subunit -
PQQ04_RS22475 (4612887) 4612887..4613816 + 930 WP_000027730.1 formate dehydrogenase accessory protein FdhE -
PQQ04_RS22480 (4613863) 4613863..4614153 - 291 WP_000362050.1 DNA-binding transcriptional regulator -
PQQ04_RS22485 (4614154) 4614154..4614465 - 312 WP_001159635.1 cytotoxic translational repressor of toxin-antitoxin stability system -
PQQ04_RS22490 (4614683) 4614683..4615612 + 930 WP_001127706.1 alpha/beta hydrolase -
PQQ04_RS22495 (4615698) 4615698..4616009 + 312 WP_000558162.1 type II toxin-antitoxin system HigB family toxin Toxin
PQQ04_RS22500 (4616006) 4616006..4616452 + 447 WP_001259009.1 type II toxin-antitoxin system HigA family antitoxin Antitoxin
PQQ04_RS22505 (4616467) 4616467..4617408 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
PQQ04_RS22510 (4617453) 4617453..4617890 - 438 WP_000560969.1 D-aminoacyl-tRNA deacylase -
PQQ04_RS22515 (4617887) 4617887..4618759 - 873 WP_000921423.1 virulence factor BrkB family protein -
PQQ04_RS22520 (4618753) 4618753..4619352 - 600 WP_000965695.1 glucose-1-phosphatase -
PQQ04_RS22525 (4619543) 4619543..4620346 - 804 WP_000059693.1 DeoR/GlpR family DNA-binding transcription regulator -
PQQ04_RS22530 (4620380) 4620380..4621276 - 897 WP_001651900.1 sugar kinase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(21-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(93-146)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12358.28 Da        Isoelectric Point: 9.3143

>T271056 WP_000558162.1 NZ_CP117388:4615698-4616009 [Salmonella enterica subsp. enterica serovar Uganda]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYDRGNKE

Download         Length: 312 bp

Antitoxin


Download         Length: 149 a.a.        Molecular weight: 16720.06 Da        Isoelectric Point: 6.6451

>AT271056 WP_001259009.1 NZ_CP117388:4616006-4616452 [Salmonella enterica subsp. enterica serovar Uganda]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE

Download         Length: 447 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References