Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 1901284..1901944 | Replicon | chromosome |
Accession | NZ_CP117388 | ||
Organism | Salmonella enterica subsp. enterica serovar Uganda strain RM010 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A623V7Z2 |
Locus tag | PQQ04_RS09105 | Protein ID | WP_000269842.1 |
Coordinates | 1901284..1901637 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PQQ04_RS09110 | Protein ID | WP_000533827.1 |
Coordinates | 1901642..1901944 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ04_RS09080 (1897349) | 1897349..1898104 | + | 756 | WP_001089670.1 | multiubiquitin domain-containing protein | - |
PQQ04_RS09085 (1898079) | 1898079..1899263 | + | 1185 | WP_076741638.1 | ThiF family adenylyltransferase | - |
PQQ04_RS09090 (1899257) | 1899257..1899721 | + | 465 | WP_001660343.1 | DUF6527 family protein | - |
PQQ04_RS09095 (1900102) | 1900102..1900569 | + | 468 | WP_000201266.1 | hypothetical protein | - |
PQQ04_RS09100 (1900566) | 1900566..1900787 | + | 222 | WP_000813787.1 | helix-turn-helix transcriptional regulator | - |
PQQ04_RS09105 (1901284) | 1901284..1901637 | + | 354 | WP_000269842.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PQQ04_RS09110 (1901642) | 1901642..1901944 | + | 303 | WP_000533827.1 | XRE family transcriptional regulator | Antitoxin |
PQQ04_RS09115 (1902450) | 1902450..1903334 | + | 885 | WP_000511750.1 | integrase domain-containing protein | - |
PQQ04_RS09120 (1904203) | 1904203..1905465 | - | 1263 | WP_076741637.1 | integrase arm-type DNA-binding domain-containing protein | - |
PQQ04_RS09130 (1905803) | 1905803..1906600 | - | 798 | WP_000598920.1 | DgsA anti-repressor MtfA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1882176..1911380 | 29204 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13476.36 Da Isoelectric Point: 9.9199
>T271040 WP_000269842.1 NZ_CP117388:1901284-1901637 [Salmonella enterica subsp. enterica serovar Uganda]
VWTIKTTDTFDRWFASLNDTNRVSVLAALLVLREKGPGLSRPYADTVRGSRYSNMKELRIQSRGEPIRAFFAFDPTRTGI
VLCAGNKVGNEKRFYDEMLPVADREFTNWLNTLKEKE
VWTIKTTDTFDRWFASLNDTNRVSVLAALLVLREKGPGLSRPYADTVRGSRYSNMKELRIQSRGEPIRAFFAFDPTRTGI
VLCAGNKVGNEKRFYDEMLPVADREFTNWLNTLKEKE
Download Length: 354 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11040.81 Da Isoelectric Point: 5.7316
>AT271040 WP_000533827.1 NZ_CP117388:1901642-1901944 [Salmonella enterica subsp. enterica serovar Uganda]
MGRTLEQLIADEKPEVVAEAQAMATDILLNIHLAELREKVQKTQVEMAQALGIRQPTVAGMEKPGRDLKLSTLKRYVEAT
GGKLRLDVELPDGSHYGFVL
MGRTLEQLIADEKPEVVAEAQAMATDILLNIHLAELREKVQKTQVEMAQALGIRQPTVAGMEKPGRDLKLSTLKRYVEAT
GGKLRLDVELPDGSHYGFVL
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|