Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 2591284..2591944 | Replicon | chromosome |
Accession | NZ_CP117386 | ||
Organism | Salmonella enterica subsp. enterica serovar Uganda strain RM011 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A623V7Z2 |
Locus tag | PQP90_RS12785 | Protein ID | WP_000269842.1 |
Coordinates | 2591591..2591944 (-) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PQP90_RS12780 | Protein ID | WP_000533827.1 |
Coordinates | 2591284..2591586 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP90_RS12760 (2586628) | 2586628..2587425 | + | 798 | WP_000598920.1 | DgsA anti-repressor MtfA | - |
PQP90_RS12770 (2587763) | 2587763..2589025 | + | 1263 | WP_076741637.1 | integrase arm-type DNA-binding domain-containing protein | - |
PQP90_RS12775 (2589894) | 2589894..2590778 | - | 885 | WP_000511750.1 | integrase domain-containing protein | - |
PQP90_RS12780 (2591284) | 2591284..2591586 | - | 303 | WP_000533827.1 | XRE family transcriptional regulator | Antitoxin |
PQP90_RS12785 (2591591) | 2591591..2591944 | - | 354 | WP_000269842.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PQP90_RS12790 (2592441) | 2592441..2592662 | - | 222 | WP_000813787.1 | helix-turn-helix transcriptional regulator | - |
PQP90_RS12795 (2592659) | 2592659..2593126 | - | 468 | WP_000201266.1 | hypothetical protein | - |
PQP90_RS12800 (2593507) | 2593507..2593971 | - | 465 | WP_001660343.1 | DUF6527 family protein | - |
PQP90_RS12805 (2593965) | 2593965..2595149 | - | 1185 | WP_076741638.1 | ThiF family adenylyltransferase | - |
PQP90_RS12810 (2595124) | 2595124..2595879 | - | 756 | WP_001089670.1 | multiubiquitin domain-containing protein | - |
PQP90_RS12815 (2595967) | 2595967..2596572 | - | 606 | WP_274897597.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2578608..2599351 | 20743 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13476.36 Da Isoelectric Point: 9.9199
>T271023 WP_000269842.1 NZ_CP117386:c2591944-2591591 [Salmonella enterica subsp. enterica serovar Uganda]
VWTIKTTDTFDRWFASLNDTNRVSVLAALLVLREKGPGLSRPYADTVRGSRYSNMKELRIQSRGEPIRAFFAFDPTRTGI
VLCAGNKVGNEKRFYDEMLPVADREFTNWLNTLKEKE
VWTIKTTDTFDRWFASLNDTNRVSVLAALLVLREKGPGLSRPYADTVRGSRYSNMKELRIQSRGEPIRAFFAFDPTRTGI
VLCAGNKVGNEKRFYDEMLPVADREFTNWLNTLKEKE
Download Length: 354 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11040.81 Da Isoelectric Point: 5.7316
>AT271023 WP_000533827.1 NZ_CP117386:c2591586-2591284 [Salmonella enterica subsp. enterica serovar Uganda]
MGRTLEQLIADEKPEVVAEAQAMATDILLNIHLAELREKVQKTQVEMAQALGIRQPTVAGMEKPGRDLKLSTLKRYVEAT
GGKLRLDVELPDGSHYGFVL
MGRTLEQLIADEKPEVVAEAQAMATDILLNIHLAELREKVQKTQVEMAQALGIRQPTVAGMEKPGRDLKLSTLKRYVEAT
GGKLRLDVELPDGSHYGFVL
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|