Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 4615887..4616641 Replicon chromosome
Accession NZ_CP117384
Organism Salmonella enterica subsp. enterica serovar Uganda strain RM013

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag PQP89_RS22485 Protein ID WP_000558162.1
Coordinates 4615887..4616198 (+) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag PQP89_RS22490 Protein ID WP_001259009.1
Coordinates 4616195..4616641 (+) Length 149 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP89_RS22455 (4611545) 4611545..4612447 + 903 WP_000331364.1 formate dehydrogenase subunit beta -
PQP89_RS22460 (4612444) 4612444..4613079 + 636 WP_000829028.1 formate dehydrogenase cytochrome b556 subunit -
PQP89_RS22465 (4613076) 4613076..4614005 + 930 WP_000027730.1 formate dehydrogenase accessory protein FdhE -
PQP89_RS22470 (4614052) 4614052..4614342 - 291 WP_000362050.1 DNA-binding transcriptional regulator -
PQP89_RS22475 (4614343) 4614343..4614654 - 312 WP_001159635.1 cytotoxic translational repressor of toxin-antitoxin stability system -
PQP89_RS22480 (4614872) 4614872..4615801 + 930 WP_001127706.1 alpha/beta hydrolase -
PQP89_RS22485 (4615887) 4615887..4616198 + 312 WP_000558162.1 type II toxin-antitoxin system HigB family toxin Toxin
PQP89_RS22490 (4616195) 4616195..4616641 + 447 WP_001259009.1 type II toxin-antitoxin system HigA family antitoxin Antitoxin
PQP89_RS22495 (4616656) 4616656..4617597 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
PQP89_RS22500 (4617642) 4617642..4618079 - 438 WP_000560969.1 D-aminoacyl-tRNA deacylase -
PQP89_RS22505 (4618076) 4618076..4618948 - 873 WP_000921423.1 virulence factor BrkB family protein -
PQP89_RS22510 (4618942) 4618942..4619541 - 600 WP_000965695.1 glucose-1-phosphatase -
PQP89_RS22515 (4619732) 4619732..4620535 - 804 WP_000059693.1 DeoR/GlpR family DNA-binding transcription regulator -
PQP89_RS22520 (4620569) 4620569..4621465 - 897 WP_001651900.1 sugar kinase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(21-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(93-146)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12358.28 Da        Isoelectric Point: 9.3143

>T271012 WP_000558162.1 NZ_CP117384:4615887-4616198 [Salmonella enterica subsp. enterica serovar Uganda]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYDRGNKE

Download         Length: 312 bp

Antitoxin


Download         Length: 149 a.a.        Molecular weight: 16720.06 Da        Isoelectric Point: 6.6451

>AT271012 WP_001259009.1 NZ_CP117384:4616195-4616641 [Salmonella enterica subsp. enterica serovar Uganda]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE

Download         Length: 447 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References