Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 1901425..1902085 | Replicon | chromosome |
| Accession | NZ_CP117384 | ||
| Organism | Salmonella enterica subsp. enterica serovar Uganda strain RM013 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A623V7Z2 |
| Locus tag | PQP89_RS09100 | Protein ID | WP_000269842.1 |
| Coordinates | 1901425..1901778 (+) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PQP89_RS09105 | Protein ID | WP_000533827.1 |
| Coordinates | 1901783..1902085 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP89_RS09075 (1897490) | 1897490..1898245 | + | 756 | WP_001089670.1 | multiubiquitin domain-containing protein | - |
| PQP89_RS09080 (1898220) | 1898220..1899404 | + | 1185 | WP_076741638.1 | ThiF family adenylyltransferase | - |
| PQP89_RS09085 (1899398) | 1899398..1899862 | + | 465 | WP_001660343.1 | DUF6527 family protein | - |
| PQP89_RS09090 (1900243) | 1900243..1900710 | + | 468 | WP_000201266.1 | hypothetical protein | - |
| PQP89_RS09095 (1900707) | 1900707..1900928 | + | 222 | WP_000813787.1 | helix-turn-helix transcriptional regulator | - |
| PQP89_RS09100 (1901425) | 1901425..1901778 | + | 354 | WP_000269842.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQP89_RS09105 (1901783) | 1901783..1902085 | + | 303 | WP_000533827.1 | XRE family transcriptional regulator | Antitoxin |
| PQP89_RS09110 (1902591) | 1902591..1903475 | + | 885 | WP_000511750.1 | integrase domain-containing protein | - |
| PQP89_RS09115 (1904344) | 1904344..1905606 | - | 1263 | WP_076741637.1 | integrase arm-type DNA-binding domain-containing protein | - |
| PQP89_RS09125 (1905944) | 1905944..1906741 | - | 798 | WP_000598920.1 | DgsA anti-repressor MtfA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1882317..1911521 | 29204 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13476.36 Da Isoelectric Point: 9.9199
>T270996 WP_000269842.1 NZ_CP117384:1901425-1901778 [Salmonella enterica subsp. enterica serovar Uganda]
VWTIKTTDTFDRWFASLNDTNRVSVLAALLVLREKGPGLSRPYADTVRGSRYSNMKELRIQSRGEPIRAFFAFDPTRTGI
VLCAGNKVGNEKRFYDEMLPVADREFTNWLNTLKEKE
VWTIKTTDTFDRWFASLNDTNRVSVLAALLVLREKGPGLSRPYADTVRGSRYSNMKELRIQSRGEPIRAFFAFDPTRTGI
VLCAGNKVGNEKRFYDEMLPVADREFTNWLNTLKEKE
Download Length: 354 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11040.81 Da Isoelectric Point: 5.7316
>AT270996 WP_000533827.1 NZ_CP117384:1901783-1902085 [Salmonella enterica subsp. enterica serovar Uganda]
MGRTLEQLIADEKPEVVAEAQAMATDILLNIHLAELREKVQKTQVEMAQALGIRQPTVAGMEKPGRDLKLSTLKRYVEAT
GGKLRLDVELPDGSHYGFVL
MGRTLEQLIADEKPEVVAEAQAMATDILLNIHLAELREKVQKTQVEMAQALGIRQPTVAGMEKPGRDLKLSTLKRYVEAT
GGKLRLDVELPDGSHYGFVL
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|