Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 4615489..4616243 Replicon chromosome
Accession NZ_CP117382
Organism Salmonella enterica subsp. enterica serovar Uganda strain RM018

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag PQP98_RS22485 Protein ID WP_000558162.1
Coordinates 4615489..4615800 (+) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag PQP98_RS22490 Protein ID WP_001259009.1
Coordinates 4615797..4616243 (+) Length 149 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP98_RS22455 (4611147) 4611147..4612049 + 903 WP_000331364.1 formate dehydrogenase subunit beta -
PQP98_RS22460 (4612046) 4612046..4612681 + 636 WP_274877692.1 formate dehydrogenase cytochrome b556 subunit -
PQP98_RS22465 (4612678) 4612678..4613607 + 930 WP_000027730.1 formate dehydrogenase accessory protein FdhE -
PQP98_RS22470 (4613654) 4613654..4613944 - 291 WP_000362050.1 DNA-binding transcriptional regulator -
PQP98_RS22475 (4613945) 4613945..4614256 - 312 WP_001159635.1 cytotoxic translational repressor of toxin-antitoxin stability system -
PQP98_RS22480 (4614474) 4614474..4615403 + 930 WP_001127706.1 alpha/beta hydrolase -
PQP98_RS22485 (4615489) 4615489..4615800 + 312 WP_000558162.1 type II toxin-antitoxin system HigB family toxin Toxin
PQP98_RS22490 (4615797) 4615797..4616243 + 447 WP_001259009.1 type II toxin-antitoxin system HigA family antitoxin Antitoxin
PQP98_RS22495 (4616258) 4616258..4617199 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
PQP98_RS22500 (4617244) 4617244..4617681 - 438 WP_000560969.1 D-aminoacyl-tRNA deacylase -
PQP98_RS22505 (4617678) 4617678..4618550 - 873 WP_000921423.1 virulence factor BrkB family protein -
PQP98_RS22510 (4618544) 4618544..4619143 - 600 WP_000965695.1 glucose-1-phosphatase -
PQP98_RS22515 (4619334) 4619334..4620137 - 804 WP_000059693.1 DeoR/GlpR family DNA-binding transcription regulator -
PQP98_RS22520 (4620171) 4620171..4621067 - 897 WP_001651900.1 sugar kinase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(21-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(93-146)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12358.28 Da        Isoelectric Point: 9.3143

>T270990 WP_000558162.1 NZ_CP117382:4615489-4615800 [Salmonella enterica subsp. enterica serovar Uganda]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYDRGNKE

Download         Length: 312 bp

Antitoxin


Download         Length: 149 a.a.        Molecular weight: 16720.06 Da        Isoelectric Point: 6.6451

>AT270990 WP_001259009.1 NZ_CP117382:4615797-4616243 [Salmonella enterica subsp. enterica serovar Uganda]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE

Download         Length: 447 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References