Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 1901107..1901767 | Replicon | chromosome |
Accession | NZ_CP117382 | ||
Organism | Salmonella enterica subsp. enterica serovar Uganda strain RM018 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A623V7Z2 |
Locus tag | PQP98_RS09090 | Protein ID | WP_000269842.1 |
Coordinates | 1901107..1901460 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PQP98_RS09095 | Protein ID | WP_000533827.1 |
Coordinates | 1901465..1901767 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP98_RS09065 (1897172) | 1897172..1897927 | + | 756 | WP_001089670.1 | multiubiquitin domain-containing protein | - |
PQP98_RS09070 (1897902) | 1897902..1899086 | + | 1185 | WP_076741638.1 | ThiF family adenylyltransferase | - |
PQP98_RS09075 (1899080) | 1899080..1899544 | + | 465 | WP_001660343.1 | DUF6527 family protein | - |
PQP98_RS09080 (1899925) | 1899925..1900392 | + | 468 | WP_000201266.1 | hypothetical protein | - |
PQP98_RS09085 (1900389) | 1900389..1900610 | + | 222 | WP_000813787.1 | helix-turn-helix transcriptional regulator | - |
PQP98_RS09090 (1901107) | 1901107..1901460 | + | 354 | WP_000269842.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PQP98_RS09095 (1901465) | 1901465..1901767 | + | 303 | WP_000533827.1 | XRE family transcriptional regulator | Antitoxin |
PQP98_RS09100 (1902273) | 1902273..1903157 | + | 885 | WP_000511750.1 | integrase domain-containing protein | - |
PQP98_RS09105 (1904026) | 1904026..1905288 | - | 1263 | WP_076741637.1 | integrase arm-type DNA-binding domain-containing protein | - |
PQP98_RS09115 (1905626) | 1905626..1906423 | - | 798 | WP_000598920.1 | DgsA anti-repressor MtfA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1881999..1911203 | 29204 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13476.36 Da Isoelectric Point: 9.9199
>T270974 WP_000269842.1 NZ_CP117382:1901107-1901460 [Salmonella enterica subsp. enterica serovar Uganda]
VWTIKTTDTFDRWFASLNDTNRVSVLAALLVLREKGPGLSRPYADTVRGSRYSNMKELRIQSRGEPIRAFFAFDPTRTGI
VLCAGNKVGNEKRFYDEMLPVADREFTNWLNTLKEKE
VWTIKTTDTFDRWFASLNDTNRVSVLAALLVLREKGPGLSRPYADTVRGSRYSNMKELRIQSRGEPIRAFFAFDPTRTGI
VLCAGNKVGNEKRFYDEMLPVADREFTNWLNTLKEKE
Download Length: 354 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11040.81 Da Isoelectric Point: 5.7316
>AT270974 WP_000533827.1 NZ_CP117382:1901465-1901767 [Salmonella enterica subsp. enterica serovar Uganda]
MGRTLEQLIADEKPEVVAEAQAMATDILLNIHLAELREKVQKTQVEMAQALGIRQPTVAGMEKPGRDLKLSTLKRYVEAT
GGKLRLDVELPDGSHYGFVL
MGRTLEQLIADEKPEVVAEAQAMATDILLNIHLAELREKVQKTQVEMAQALGIRQPTVAGMEKPGRDLKLSTLKRYVEAT
GGKLRLDVELPDGSHYGFVL
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|