Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-RelB |
Location | 357999..358537 | Replicon | chromosome |
Accession | NZ_CP117373 | ||
Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM043 |
Toxin (Protein)
Gene name | yafQ | Uniprot ID | M7RHM1 |
Locus tag | PQQ08_RS01630 | Protein ID | WP_001526148.1 |
Coordinates | 358262..358537 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | M7RMV7 |
Locus tag | PQQ08_RS01625 | Protein ID | WP_000729713.1 |
Coordinates | 357999..358259 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ08_RS01610 (353760) | 353760..355313 | + | 1554 | WP_000013013.1 | TROVE domain-containing protein | - |
PQQ08_RS01615 (355661) | 355661..356875 | + | 1215 | WP_052895987.1 | RNA-splicing ligase RtcB | - |
PQQ08_RS01620 (356879) | 356879..357890 | + | 1012 | Protein_319 | RNA 3'-terminal phosphate cyclase | - |
PQQ08_RS01625 (357999) | 357999..358259 | + | 261 | WP_000729713.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PQQ08_RS01630 (358262) | 358262..358537 | + | 276 | WP_001526148.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
PQQ08_RS01635 (358625) | 358625..361330 | - | 2706 | WP_000907030.1 | HTH-type transcriptional regulator MalT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10739.34 Da Isoelectric Point: 8.8652
>T270903 WP_001526148.1 NZ_CP117373:358262-358537 [Salmonella enterica subsp. enterica serovar Dublin]
MGQREIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIEPDWILIYKITDECLR
FERTGTHADLF
MGQREIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIEPDWILIYKITDECLR
FERTGTHADLF
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V4SM83 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4D6P2L2 |